KEGG   Bacillus subtilis subsp. subtilis 168: BSU03830Help
Entry
BSU03830          CDS       T00010                                 

Gene name
yclQ
Definition
(RefSeq) ABC transporter substrate-binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03830 (yclQ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    BSU03830 (yclQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 Inhibitor_I53
Motif
Other DBs
NCBI-GeneID: 938277
NCBI-ProteinID: NP_388265
Pasteur: BG12037
BSORF: BG12037
UniProt: P94421
Structure
PDB: 

Position
435036..435989
Genome map
AA seq 317 aa AA seqDB search
MKKFALLFIALVTAVVISACGNQSTSSKGSDTKKEQITVKHQLDKNGTKVPKNPKKVVVF
DFGSLDTLDKLGLDDIVAGLPKQVLPKYLSKFKDDKYADVGSLKEPDFDKVAELDPDLII
ISARQSESYKEFSKIAPTIYLGVDTAKYMESFKSDAETIGKIFDKEDKVKDELANIDHSI
ADVKKTAEKLNKNGLVIMANDGKISAFGPKSRYGLIHDVFGVAPADQNIKASTHGQSVSY
EYISKTNPDYLFVIDRGTAIGETSSTKQVVENDYVKNVNAVKNGHVIYLDSATWYLSGGG
LESMTQMIKEVKDGLEK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcgcgttactattcatcgctttggtcactgccgttgtcatttctgcatgc
ggaaaccaaagcacaagcagcaaaggttctgatacaaagaaagaacaaatcacagtgaaa
caccagctcgacaaaaacggcacaaaagtaccgaagaaccctaaaaaagttgtcgtattt
gactttggaagcttagatacattagataaactaggacttgatgatatagtagcgggcctg
ccgaaacaagtccttcctaaatatctgtccaaattcaaggatgacaaatacgctgatgtc
ggcagcttaaaagagccagacttcgacaaagtggcagaattagatcctgatctgatcatt
atttcagcaagacaatctgagtcttacaaagaattctctaaaattgcgccgacgatttac
cttggtgtagatacagcgaagtacatggaatcatttaaatcagacgctgaaacaatcggt
aaaatctttgataaagaagacaaagtgaaagatgagctcgcaaacattgatcactcaatc
gcagatgtaaagaaaaccgctgaaaagcttaacaaaaacggtctcgtcatcatggcgaac
gatggaaaaatcagcgcgttcggccctaaatcaagatacggcctgatccatgacgtattc
ggcgtggctccggctgatcaaaacatcaaagcgtctacgcacggacaaagtgtttcttac
gagtacatttcaaaaacaaaccctgattacttgtttgttattgaccgcggtacagcaatc
ggagaaacatcatctacaaaacaagtcgtggaaaacgattatgtgaaaaacgtaaacgca
gtgaaaaatggtcatgtcatctaccttgattctgctacttggtatttatcaggaggcgga
cttgagtctatgacgcaaatgattaaagaagtgaaagacggtttagaaaagtaa

DBGET integrated database retrieval system