KEGG   Bacillus subtilis subsp. subtilis 168: BSU03840Help
Entry
BSU03840          CDS       T00010                                 

Gene name
ycnB
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2
Motif
Other DBs
NCBI-GeneID: 938275
NCBI-ProteinID: NP_388266
Pasteur: BG12038
BSORF: BG12038
UniProt: P94422
Position
complement(436036..437454)
Genome map
AA seq 472 aa AA seqDB search
MNTSIEQKPFNRSVIVGILLAGAFVAILNQTLLITALPHIMRDFNVDANQAQWLTTSFML
TNGILIPITAFLIEKFTSRALLITAMSIFTAGTVVGAFAPNFPVLLTARIIQAAGAGIMM
PLMQTVFLTIFPIEKRGQAMGMVGLVISFAPAIGPTLSGWAVEAFSWRSLFYIILPFAVI
DLILASILMKNVTTLRKTQIDILSVILSTFGFGGLLYGFSSVGSYGWSSSTVLISLLVGV
IALLLFITRQMKLKKPMLEFRVFTFGVFSLTTLLGTLVFALLIGTETILPLYTQNVRDVT
AFDTGLMLLPGAVVMGFMSPIIGRIFDRVGGRGLAIAGFCIIFLTSLPFMQLTDHTSLAW
IVVLYTVRLLGTAMIMMPVTTAGINALPRHLIPHGTAMNNTIRQVGGSIGTALLVSVMSN
QAAHAGTTNVKHAALHGMNAAFIVAAVIALVGFLLSFTLKKPQRPAEQQPAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaagtattgaacaaaaaccttttaaccgttctgtcattgtcggcattttgtta
gccggagcgtttgtggcgattttgaaccagacattgttgattactgcacttccccatatc
atgagggatttcaatgtcgatgccaaccaagcacaatggctgacaacatcatttatgtta
accaacgggattttaattccgattaccgcgtttttaattgagaaattcacaagccgggcg
ctgctcatcacagcaatgagcattttcactgccggaacagtcgtcggagcgttcgcgccg
aacttcccggttctgctgacagcgcgtatcattcaagcggctggagccggcattatgatg
ccgctcatgcagactgtattcctgacaatctttccgattgaaaagcgcggccaggctatg
ggtatggtcggattggtcatctcattcgcgcctgcgatcggaccgactctttccggatgg
gctgtcgaagctttctcttggagatcattgttttatattattcttccgtttgctgtgatt
gatttgattcttgccagcatcctgatgaaaaacgtgacgactttaagaaaaacacagatt
gatattttatcagtcatcctttcaacatttgggttcggcggccttctgtacggcttctca
agcgtcggctcttatggctggtccagttcaaccgtcttgatttcactgctggtgggtgtc
atcgcgctgctcttgtttatcacaagacaaatgaagcttaaaaaaccgatgctggaattc
cgcgtcttcacgtttggcgttttcagcttaacaacactgctgggaaccctcgtctttgca
ttattgatcggtacggaaaccatcctgccgctttatacacaaaatgtcagagacgtcaca
gcttttgatacagggcttatgctcctgccgggagccgttgtgatgggctttatgtcgccg
attatcggcagaatttttgaccgtgtcggcggaagagggctggcgattgccggtttctgc
atcatcttcctgacatctctgccgtttatgcagctgactgaccatacgtcactcgcttgg
attgtcgttttatacaccgttcgtctcttaggcaccgccatgatcatgatgccggtgaca
acagccggaatcaatgcgctgccgcgccacttgattccgcacggaactgcgatgaacaac
acgattcgccaagtcggcggctcgatcggaaccgcactattggtttccgtgatgagcaac
caggcggcacatgcaggcacgacaaatgtgaagcacgccgccctgcacggcatgaacgcc
gcttttatagtggctgccgtcattgcacttgtcggcttccttctctcattcacattaaag
aaacctcagcgccctgccgaacagcagccggcacgctga

DBGET integrated database retrieval system