KEGG   Bacillus subtilis subsp. subtilis 168: BSU03850Help
Entry
BSU03850          CDS       T00010                                 

Gene name
ycnC
Definition
(RefSeq) TetR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N UPF0122 HTH_Tnp_1_2 HTH_6
Motif
Other DBs
NCBI-GeneID: 938270
NCBI-ProteinID: NP_388267
Pasteur: BG12039
BSORF: BG12039
UniProt: P94423
Position
complement(437474..438352)
Genome map
AA seq 292 aa AA seqDB search
MLDKKTDILLAARKLFSEKDFTSVSMQAIAEECKMSKASIYKLFQSKEDLLLELLSFNQK
QMVAAASRLQENTALTPEERLTQKVKMELEGFRRNQQFFNMLTYGNPKLHNDRVKQHIHQ
TRSTIICWHRDSLIQAYGETILPFVWDLVIILHGMMREFLMLIKIEEKPLELDPIAEFII
STLNQIIKNRETRQSLLPPEAIELYIHSASSYKPKDKSVLLSESLKELHKGISSLSAADY
DVDELTSAAAMLEEEAKKEEPRAFLLKSLIGYLEQTGVLTQPVSMLKTLLIT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataaaaaaacagatatcttgttagccgcgcgaaagcttttttcggaaaaggat
tttacgtcggtttccatgcaggcgatcgcagaagaatgtaagatgtcaaaagcttcgata
tataagctgttccaatctaaagaagatctgcttttggagctgctgtcatttaaccagaag
caaatggtggccgcggcctcaagacttcaggaaaatacagcacttacaccggaggagcgt
ttgacgcaaaaggtcaaaatggaactggagggcttcaggcggaatcagcagtttttcaat
atgctgacctacggaaaccccaagctgcacaatgaccgggtcaaacagcatatccatcag
accagatcgacgattatctgctggcaccgcgattcgctgatccaggcgtatggagaaacc
attctcccgtttgtgtgggatttggttatcattcttcacggcatgatgcgtgagttttta
atgctgatcaaaatcgaggaaaaaccgcttgagcttgacccgatcgcagagtttatcatc
agcaccctcaatcagattatcaaaaacagggaaacccgccagtctcttcttccgcccgaa
gccatcgagctttatattcattcagcatcctcctacaagccaaaggataaatcagtccta
ttatcggaaagcctgaaggaattacataaaggcatctcttccctgtccgccgcggactat
gacgtagatgaactgacatccgcagccgctatgctggaggaagaagcgaagaaggaagaa
ccccgcgcttttttactcaaatcactgattggctatctggaacaaaccggtgttttaaca
cagcccgtttccatgttaaaaacactgttaattacttag

DBGET integrated database retrieval system