KEGG   Bacillus subtilis subsp. subtilis 168: BSU03860Help
Entry
BSU03860          CDS       T00010                                 

Gene name
ycnD
Definition
(RefSeq) FMN reductase
  KO
K19286  FMN reductase [NAD(P)H] [EC:1.5.1.39]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00740  Riboflavin metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSU03860 (ycnD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.39  FMN reductase [NAD(P)H]
     BSU03860 (ycnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-GeneID: 938267
NCBI-ProteinID: NP_388268
Pasteur: BG12040
BSORF: BG12040
UniProt: P94424
Structure
PDB: 

Position
complement(438516..439265)
Genome map
AA seq 249 aa AA seqDB search
MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQVTVITVQDKERKKKI
SELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGLESVLVGAVDAGIALGT
ATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVIGHPADRSAKKPRLPQEA
VNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQSIASYYERLYYPHIREML
EKQGFKVEK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgattaaatctttaacagaccaccgctcgattcgcagctacacagatgag
cctgtagctcaggagcaattggaccaaatcattgaagcggtgcaatcagccccttcttct
atcaacggacagcaagtgactgtgatcacagtccaggataaagagcgcaaaaagaaaatc
tccgagctggcaggcggccagccatggatcgatcaagctcctgttttcctgctgttctgc
gcagattttaaccgggccaaaattgcgcttgaagatctgcatgatttcaaaatggaaatc
acaaatggattggaatctgttcttgtcggcgcagtagacgctggtattgccctcggcaca
gcaacagcagcggctgagtcactcggacttggcacagttccgatcggtgcagttcgcgga
aaccctcaagagctgatcgaactgcttgagcttccgaaatacgtgttccctttatccggc
cttgtcattgggcatcctgccgaccgttcagcgaaaaaaccgcgcttgccgcaggaagct
gtcaatcatcaggaaacttatttgaatcaggatgagctgacgtctcacattcaggcatac
gacgaacagatgtctgaatacatgaataaacggacaaacggaaaagaaacaagaaactgg
tcacagagcatcgcttcctactatgagcgcctgtactatccgcacatccgtgaaatgctt
gaaaaacaaggatttaaagttgaaaaataa

DBGET integrated database retrieval system