KEGG   Bacillus subtilis subsp. subtilis 168: BSU03870Help
Entry
BSU03870          CDS       T00010                                 

Gene name
ycnE
Definition
(RefSeq) monooxygenase YcnE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABM NIPSNAP
Motif
Other DBs
NCBI-GeneID: 938274
NCBI-ProteinID: NP_388269
Pasteur: BG12041
BSORF: BG12041
UniProt: P94425
Position
complement(439282..439569)
Genome map
AA seq 95 aa AA seqDB search
MIVLQAYIKVKPEKREEFLSEAQSLVQHSRAEEGNAQYDLFEKVGEENTFVMLEKWKDEA
AMKFHNETAHFQGFVAKGKELLSAPLDVVRTELSE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtattacaagcttacatcaaagtaaaaccagaaaaacgcgaggaatttttgagc
gaggctcaatcacttgttcagcattcaagagctgaggaaggcaacgcgcaatacgaccta
ttcgaaaaagtaggcgaagaaaatacatttgtcatgcttgaaaaatggaaagatgaagcg
gcaatgaaattccataacgaaactgcgcatttccaagggtttgtcgcaaaaggaaaagaa
ctgctgagcgctcctcttgatgttgtccgcacagagcttagcgagtaa

DBGET integrated database retrieval system