KEGG   Bacillus subtilis subsp. subtilis 168: BSU03880Help
Entry
BSU03880          CDS       T00010                                 

Gene name
yczG
Definition
(RefSeq) ArsR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_5 HTH_20 Arg_repressor
Motif
Other DBs
NCBI-GeneID: 938272
NCBI-ProteinID: NP_388270
Pasteur: BG12781
BSORF: BG12781
UniProt: O31480
Position
439709..440023
Genome map
AA seq 104 aa AA seqDB search
MNIPNHPETETLQLTKVLHALSDPLRLELVKQLAEAKEKTCSTCADVQVAKSTLSHHFKV
LRESGIAQVRIEGKRRYYSLRAEDLEKAFPGLLEAVLNVDQDRW
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaacattccaaaccatccagaaacagaaacattgcagctgacaaaggttcttcatgca
cttagtgatccgcttcgtttagagctcgtcaagcaattagctgaagcaaaagaaaaaacg
tgcagcacctgtgcagatgtgcaggttgccaaatcgactttgtcgcatcattttaaagtt
ttgagagaatcaggcatcgctcaagttcggatagaaggaaagcgccggtattattcgctt
cgcgctgaagaccttgaaaaggcatttccgggactgcttgaagccgtgctgaatgtagac
caggaccgctggtga

DBGET integrated database retrieval system