KEGG   Bacillus subtilis subsp. subtilis 168: BSU03900Help
Entry
BSU03900          CDS       T00010                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00280  Valine, leucine and isoleucine degradation
bsu00310  Lysine degradation
bsu00410  beta-Alanine metabolism
bsu00640  Propanoate metabolism
bsu00650  Butanoate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU03900 (gabT)
   00650 Butanoate metabolism
    BSU03900 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU03900 (gabT)
   00280 Valine, leucine and isoleucine degradation
    BSU03900 (gabT)
   00310 Lysine degradation
    BSU03900 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU03900 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU03900 (gabT)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BSU03900 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     BSU03900 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     BSU03900 (gabT)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class III
   BSU03900 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 938264
NCBI-ProteinID: NP_388272
Pasteur: BG12043
BSORF: BG12043
UniProt: P94427
Position
441571..442881
Genome map
AA seq 436 aa AA seqDB search
MSQTTASITTAQWQQKRDQFVSKGVSNGNRSLAVKGEGAELYDLDGRRFIDFAGAIGTLN
VGHSHPKVVEAVKRQAEELIHPGFNVMMYPTYIELAEKLCGIAPGSHEKKAIFLNSGAEA
VENAVKIARKYTKRQGVVSFTRGFHGRTNMTMSMTSKVKPYKFGFGPFAPEVYQAPFPYY
YQKPAGMSDESYDDMVIQAFNDFFIASVAPETVACVVMEPVQGEGGFIIPSKRFVQHVAS
FCKEHGIVFVADEIQTGFARTGTYFAIEHFDVVPDLITVSKSLAAGLPLSGVIGRAEMLD
AAAPGELGGTYAGSPLGCAAALAVLDIIEEEGLNERSEEIGKIIEDKAYEWKQEFPFIGD
IRRLGAMAAIEIVKDPDTREPDKTKAAAIAAYANQNGLLLLTAGINGNIIRFLTPLVISD
SLLNEGLSILEAGLRA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacaacagcaagcatcacaactgcacaatggcagcaaaaacgggatcaattt
gtgtcaaaaggtgtgagcaacggcaaccgcagtctggcggtcaaaggagaaggggccgag
ctgtacgatctggatggccggagatttattgattttgcaggcgccatcggcacgttaaat
gtcggacactcgcatccgaaggtggttgaggctgtgaagcggcaggcggaggagctgatt
catcctggttttaatgtcatgatgtacccgacttatatcgaattagcagaaaaactgtgc
ggcatcgcgccgggcagccatgagaaaaaagcgatttttcttaactcaggggcagaagcg
gtcgaaaacgctgtgaaaatcgccagaaagtatacaaagcgccaaggcgttgtctcgttt
acacgcgggtttcacgggcgcacgaatatgacgatgagcatgacaagcaaggtaaaacct
tataaattcggtttcgggccttttgcgccagaggtttatcaagcgccgttcccttattat
tatcagaagccggccggcatgagtgatgaaagctatgacgatatggtcattcaagcattc
aatgatttctttatcgcttcagtggcgcctgaaacggtggcgtgtgtcgtgatggagcca
gtgcagggagaaggcggatttattattccttcgaaacggttcgtacagcacgtcgcttca
ttctgcaaagaacacggcattgtttttgttgctgatgaaatccaaaccggctttgccaga
actggcacttatttcgcaattgagcactttgatgtagtgcccgatctgatcacggtttct
aaatcgcttgcggcaggcctgccattaagcggtgtgatcgggcgtgcggaaatgcttgat
gcggcagcgccaggggagctgggcggcacgtatgccggcagcccgctcggctgcgcggcg
gctttggcagtcttggatattatcgaagaagaaggactgaatgagcgatctgaagaaatt
ggcaaaatcattgaagacaaggcgtatgagtggaaacaagaattcccgttcatcggtgac
atccgcagactcggggcgatggccgcaatcgaaatcgtcaaggatcctgacacgcgtgag
cctgataagacaaaagcagcagcgatcgcggcctatgcgaatcaaaacggattacttttg
ctgacagcgggaattaacggtaatatcatccgctttttgacaccgctcgtcatctcagac
agcctattaaatgaagggctcagcatcttggaggcgggcctgcgagcttaa

DBGET integrated database retrieval system