KEGG   Bacillus subtilis subsp. subtilis 168: BSU03910Help
Entry
BSU03910          CDS       T00010                                 

Gene name
gabD
Definition
(RefSeq) succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00310  Lysine degradation
bsu00350  Tyrosine metabolism
bsu00650  Butanoate metabolism
bsu00760  Nicotinate and nicotinamide metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSU03910 (gabD)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU03910 (gabD)
   00310 Lysine degradation
    BSU03910 (gabD)
   00350 Tyrosine metabolism
    BSU03910 (gabD)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSU03910 (gabD)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     BSU03910 (gabD)
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     BSU03910 (gabD)
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     BSU03910 (gabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF4371 Peptidase_M32 DUF1487 Carbam_trans_C
Motif
Other DBs
NCBI-GeneID: 939976
NCBI-ProteinID: NP_388273
Pasteur: BG12044
BSORF: BG12044
UniProt: P94428
Position
442950..444338
Genome map
AA seq 462 aa AA seqDB search
MPDQLTVYNPATGEEIKTIPQQSATEVEEAIERSHQAFKTWSKTSANERTSLLKKWYELI
VEHKEELADLITKENGKPYQEAVGEVLYGAGYIEWFAEEAKRVYGRTVPAPTTGKRIVVT
RQPVGPVAAITPWNFPNAMITRKAAPALAAGCTFIIKPAPDTPLSAYELARLAYEAGIPK
DVLQVVIGDGEEIGNVFTSSPKIRKITFTGSTPVGKILMKNSADTVKHVSMELGGHAPLI
VDEDADIDLAVEQAMASKYRNAGQTCVCANRLIVHESIKDEFAAKLSEQVSKLKVGNGLE
EGVNVGPIINKRGFEKIVSQIDDAVEKGAKVIAGGTYDRNDDKGCYFVNPTVLTDVDTSM
NIMHEETFGPVAPIVTFSDIDEAIQLANDTPYGLAAYFFTENYRRGIYISENLEYGIIGW
NDGGPSAVQAPFGGMKESGIGREGGSEGIEPYLETKYLSIGL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcaattaacggtctacaacccggctacgggcgaggagatcaaaacgattcct
cagcaatcagccacagaggtagaagaagccattgaacgttcacatcaagcgtttaaaacg
tggtctaaaacatcagcgaacgaaagaacgtctcttttgaaaaaatggtatgagctgatt
gttgaacataaagaagagcttgcagatttaattacaaaggaaaacggaaaaccataccag
gaagcagtcggcgaggtactttacggcgcaggctatatcgaatggttcgcagaggaagcg
aagcgtgtgtacggaagaacggtcccggccccgacaactggtaaacgaattgttgtcaca
cgccagccggtcggccccgttgctgctatcacgccctggaatttcccgaatgcgatgatt
acacgcaaagcggcgcctgctcttgccgccggctgtacatttatcatcaagccggcgccg
gacacaccgctgtctgcttatgaactagcgcgcctcgcatatgaagcgggcattccgaag
gatgttcttcaggttgtgatcggcgatggagaagaaatcggaaatgtgttcacaagcagt
ccgaaaatccgcaaaatcacgttcacaggctcaacacctgtagggaaaatccttatgaaa
aacagcgctgacaccgtaaagcacgtctcaatggagctcggcggacacgccccgctgatc
gtagatgaagatgcggacattgaccttgccgttgaacaggcgatggcgtccaaataccga
aacgccggccaaacctgcgtatgtgccaaccgcctgatcgttcatgaatccattaaagat
gaatttgctgcgaaactgagcgagcaagtgtctaagctgaaagtcggaaatggacttgag
gaaggcgtcaatgtcggcccgattatcaacaaacgaggcttcgaaaaaatcgtcagccaa
atagatgatgcggttgaaaaaggcgcgaaagtgattgctgggggcacatatgaccgaaac
gatgacaaagggtgctactttgtgaatccgacagtgctcaccgatgtcgatacgtccatg
aacatcatgcatgaggaaacattcggcccggtcgccccgatcgtcacgttttctgatatt
gatgaagcgattcagcttgccaacgatacaccgtatggcttggctgcttacttcttcaca
gaaaactaccgccgcggcatctatatttccgagaatctagagtatggcattatcggctgg
aatgacggcggaccgtcagcggttcaagcgccattcggcggaatgaaagaaagcggcatc
ggccgtgaaggcggttcagaaggtatcgagccgtaccttgaaacaaaatatttgtccatc
ggtttataa

DBGET integrated database retrieval system