KEGG   Bacillus subtilis subsp. subtilis 168: BSU03920Help
Entry
BSU03920          CDS       T00010                                 

Gene name
glcU
Definition
(RefSeq) glucose uptake protein GlcU
  KO
K05340  glucose uptake protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03920 (glcU)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU03920 (glcU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_transport TMEM144 EamA TssN
Motif
Other DBs
NCBI-GeneID: 938268
NCBI-ProteinID: NP_388274
Pasteur: BG11066
BSORF: BG11066
UniProt: P40420
Position
444461..445324
Genome map
AA seq 287 aa AA seqDB search
MDLLLALLPALFWGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQPVLSLRIFIV
GIVSGLFWSLGQANQLKSIQLMGVSKTMPISTGMQLVSTSLFGVIVFREWSTPIAITLGV
LALIFIIVGIILTSLEDKNDKKEGEPSNLKKGILILLVSTLGYLVYVVVARLFNVSGWSA
LLPQAIGMVVGGLVLTYRHKPFNKYAIRNILPGLIWAGGNMFLFISQPRVGVATSFSLSQ
MGIVISTLGGIFILREKKTKRQLIAIAIGIILIIAAAVFLGIAKTNS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatttattattggctcttctcccggctttgttttgggggagcattgttctcttcaat
gtgaaattaggcggcgggccgtacagccagacactgggaacgacgatcggggcactcatt
gtttctatcgttatttacttttttgttcagcccgttctgtcccttcgcatttttattgtt
ggaatcgtatccggcttattttggtcacttggacaggccaaccagttgaaaagcattcaa
ttgatgggcgtgtcgaaaacaatgccgatttccacaggaatgcagctcgtttccacctcg
ctgttcggtgtgatcgtgttccgcgaatggtcaacaccgattgcgattacgcttggcgtt
ctcgctttgatctttatcattgtgggaatcattctcacgtccttggaagataagaatgat
aaaaaagagggcgagccaagcaatttgaaaaagggcattttgattctccttgtttcgact
cttggttatttggtttatgtagtcgtggctagattattcaatgtgtccggctggtccgcg
ctgctgccacaggcaattggcatggtggtcggggggttagttttaacctatagacacaaa
ccctttaacaagtatgcgatcagaaatattctcccagggttaatctgggcaggcggaaat
atgtttttgtttatttctcagccgcgagtcggcgttgcaacgagcttttccctttcacaa
atgggaattgtcatttctacgctcggcggtattttcatcctgcgtgaaaagaaaacgaaa
cgccagctaatagcaattgcgatcgggattatcctgattattgccgccgccgtattctta
ggaatcgccaaaacaaattcataa

DBGET integrated database retrieval system