KEGG   Bacillus subtilis subsp. subtilis 168: BSU03930
Entry
BSU03930          CDS       T00010                                 
Symbol
gdh
Name
(RefSeq) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU03930 (gdh)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BSU03930 (gdh)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Polysacc_synt_2
Other DBs
NCBI-GeneID: 938261
NCBI-ProteinID: NP_388275
Pasteur: BG10545
BSORF: BG10545
UniProt: P12310 A0A6M3Z832
Position
445344..446129
AA seq 261 aa
MYPDLKGKVVAITGAASGLGKAMAIRFGKEQAKVVINYYSNKQDPNEVKEEVIKAGGEAV
VVQGDVTKEEDVKNIVQTAIKEFGTLDIMINNAGLENPVPSHEMPLKDWDKVIGTNLTGA
FLGSREAIKYFVENDIKGNVINMSSVHEVIPWPLFVHYAASKGGIKLMTETLALEYAPKG
IRVNNIGPGAINTPINAEKFADPKQKADVESMIPMGYIGEPEEIAAVAAWLASKEASYVT
GITLFADGGMTQYPSFQAGRG
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtatccggatttaaaaggaaaagtcgtcgctattacaggagctgcttcagggctcgga
aaggcgatggccattcgcttcggcaaggagcaggcaaaagtggttatcaactattatagt
aataaacaagatccgaacgaggtaaaagaagaggtcatcaaggcgggcggtgaagctgtt
gtcgtccaaggagatgtcacgaaagaggaagatgtaaaaaatatcgtgcaaacggcaatt
aaggagttcggcacactcgatattatgattaataatgccggtcttgaaaatcctgtgcca
tctcacgaaatgccgctcaaggattgggataaagtcatcggcacgaacttaacgggtgcc
tttttaggaagccgtgaagcgattaaatatttcgtagaaaacgatatcaagggaaatgtc
attaacatgtccagtgtgcacgaagtgattccttggccgttatttgtccactatgcggca
agtaaaggcgggataaagctgatgacagaaacattagcgttggaatacgcgccgaagggc
attcgcgtcaataatattgggccaggtgcgatcaacacgccaatcaatgctgaaaaattc
gctgaccctaaacagaaagctgatgtagaaagcatgattccaatgggatatatcggcgaa
ccggaggagatcgccgcagtagcagcctggcttgcttcgaaggaagccagctacgtcaca
ggcatcacgttattcgcggacggcggtatgacacaatatccttcattccaggcaggccgc
ggttaa

DBGET integrated database retrieval system