KEGG   Bacillus subtilis subsp. subtilis 168: BSU03950Help
Entry
BSU03950          CDS       T00010                                 

Gene name
ycnJ
Definition
(RefSeq) copper transport protein YcnJ
  KO
K14166  copper transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03950 (ycnJ)
Transporters [BR:bsu02000]
 Other Transporters
  Others
   BSU03950 (ycnJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CopC CopD YtkA Y_Y_Y UAA Big_5 DUF4149
Motif
Other DBs
NCBI-GeneID: 938258
NCBI-ProteinID: NP_388277
Pasteur: BG12046
BSORF: BG12046
UniProt: C0SP95
Position
complement(446801..448426)
Genome map
AA seq 541 aa AA seqDB search
MKRNRWWIILLLFLVFLPKTSFAHAYIVKSSPGENSELKSAPAQVEIEFNEPVEEGFHYI
KVYNSNGDRVDTDKTEIKKDNHHIMTVKLKKNLPKDVYRAEWNAVSADGHPVSGVIPFSI
GKADGGFSSQKAADSALNPGTAADRAILYTALSLFIGTVFFHLFWYKGKSEQLVKRTRRI
LTGSIAALGLALLLQLPIQTKANAGGGWGSAFQPGYIRETLFETAGGSIWIIQAALFVLL
ALSVIPAIRKNRFSSFGYWTAPLIFFFGLLLAKAFTGHAAVVEEKTVGILMDFLHLTSAS
IWVGGIAALVLLLSKEWRQPDKTLAWETVRRFSPWALTAVGVILFSGLLNGFFIIRSMDS
LFHTAYGQALLVKSGLFVFMLVLGAIHFLLTRKQRRTGISRTLKAEWAIGIAVLITAAVF
TSLPSPPEPAPEPFYQTKAIENGQSVSLSISPNQPGKNVFELRVTDHNGDPVKNIQQITL
TVYKTGLSGSENKSTFTLKEKTKGVFQDQNLSINEKGNWKIKVHGLTGDFNEINIMFTKT
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaaacagatggtggatcatccttctgctttttcttgttttcctgccgaaaaca
agctttgctcacgcctatattgtcaaatcttcacctggggaaaacagcgaattaaaaagc
gcccctgcgcaggtggaaatcgaatttaatgaaccggttgaagaagggtttcattacatt
aaagtctataattcaaacggcgaccgtgtggatacggacaagactgaaatcaaaaaagat
aatcatcacatcatgacagtgaagctgaagaagaatctgcctaaagatgtgtacagagcg
gaatggaatgccgtatccgcggatggacatcctgtttccggcgtcattccgttcagtatc
gggaaagcggatggcggattcagcagccaaaaagcagccgattcagcgctgaatccggga
acagcagcagatcgcgcgattctgtatacagccttatctctgtttatcggaacggttttc
ttccatcttttctggtataaagggaaatcagaacagctcgtcaaacggacgagacgtatc
ctgaccggctcgatcgcagcattggggctggcgcttttgcttcagcttccgattcagaca
aaagcgaacgcaggcggcggctggggcagcgcattccagccgggctacatcagagaaaca
ctgtttgagacagcaggcggctccatttggatcatacaggctgcgctgttcgtgctgctc
gcactgtctgtcatccctgcgatacggaaaaaccgcttttcatcctttggctattggaca
gcgccgctcattttctttttcggtctcctgcttgccaaggcgtttaccgggcatgctgct
gtcgttgaagaaaaaacggtcggcattttgatggatttccttcatttaacttccgcttcc
atctgggtcggcggaatagcggcactcgttttgctgctctcaaaagaatggaggcagcct
gacaaaacgctcgcgtgggagacggtcagacggttctccccatgggcgctcactgcagtc
ggcgtcattttgttttcaggcttgctcaatggatttttcatcattcgttcaatggattca
ctgttccatacagcgtacggacaagctcttttagtgaaaagcgggctgtttgttttcatg
ctggtcttaggcgcaattcattttctgcttaccagaaagcagcgccgcacaggaatcagc
cgaacgttgaaagcggagtgggcaatcggcatcgctgtattgatcacagcggccgtgttt
acaagcctgccaagcccgcctgagccagcgccggaaccgttctaccaaaccaaagcgata
gagaacggacaaagcgtttctctcagcatcagcccaaaccagcctggaaaaaatgttttt
gagctgcgggtcaccgaccataacggtgatcccgtgaaaaacatccagcaaatcacgtta
accgtttataaaacaggcctgtcaggcagcgaaaacaaaagcacctttacattaaaagaa
aaaacaaaaggcgtcttccaagatcaaaacctgtcgattaatgaaaaaggaaactggaag
atcaaagtccacggcctgaccggcgactttaacgaaatcaatatcatgtttacaaagacc
aattaa

DBGET integrated database retrieval system