KEGG   Bacillus subtilis subsp. subtilis 168: BSU03960Help
Entry
BSU03960          CDS       T00010                                 

Gene name
ycnK
Definition
(RefSeq) DeoR family transcriptional regulator
  KO
K21601  DeoR family transcriptional regulator, copper-sensing transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU03960 (ycnK)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   DeoR family
    BSU03960 (ycnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_DeoR HTH_11 NosL MarR HTH_23 HTH_7 HTH_24 TrmB HTH_IclR HTH_28 HTH_5 HTH_22 HTH_AsnC-type HTH_Tnp_4 GntR HTH_Mga DUF1670 HTH_38 HTH_20 MarR_2 Sigma70_r4 HTH_29
Motif
Other DBs
NCBI-GeneID: 938265
NCBI-ProteinID: NP_388278
Pasteur: BG12047
BSORF: BG12047
UniProt: P94433
Position
complement(448461..449033)
Genome map
AA seq 190 aa AA seqDB search
MLPINRQQHILKWLKEEGSLRISDISARFGVSEMTVYRDVNQLVQSNQVIKTAGGITLPV
RTPQTDHMCSYCLKPVNQAHSVQLITVNQDIEQLCCAHCAFLRYADKTEEVSHLICRDFL
LQTTVSAGSAYFVVNAELNLHCCQPQAIPFATLDHAERFQKGFGGAVCTFDQALEDMLQD
RKKRCTCTKK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcttccgattaatagacagcaacacatactgaagtggctgaaagaagaaggctcgctt
agaatttctgacatcagcgcaaggttcggcgtttcggaaatgacggtatatagagatgtc
aatcagctggttcagtcaaatcaggtcattaaaacggccggcggcatcacgctccccgtc
cgaacacctcaaacagatcatatgtgcagctattgcttgaagcccgtcaatcaagctcat
tcggttcagctgattacggtaaaccaagacattgaacagctatgctgcgcacattgcgcg
tttttgcgttacgcggataaaacggaagaggtttcacacttgatttgcagagattttctg
ttacagacaaccgtcagtgccggttcggcttatttcgtcgtaaatgctgaattaaacctg
cactgctgccagccgcaggccattccgtttgcgacacttgaccatgccgaacgatttcaa
aaaggattcggcggagccgtctgcactttcgaccaagcgctggaagacatgcttcaagac
cgaaagaaacgctgcacctgcaccaagaaataa

DBGET integrated database retrieval system