KEGG   Bacillus subtilis subsp. subtilis 168: BSU03970Help
Entry
BSU03970          CDS       T00010                                 

Gene name
ycnL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-ribbon_3 DUF4029 zinc_ribbon_2 Zn_Tnp_IS1595 DUF983 MRAP
Motif
Other DBs
NCBI-GeneID: 939465
NCBI-ProteinID: NP_388279
Pasteur: BG12048
BSORF: BG12048
UniProt: P94434
Position
449198..449551
Genome map
AA seq 117 aa AA seqDB search
MKETPCPNCGKPLTGDMVRSSNVPCQFRCGHCRERLYEYKVSAPIMLVSLAAIVLLIYLL
MLLRNAAGSVLPAVQHVPMAVFALVCAYPVFIVSERMIAKYVIQNGNIIYRGKRKGS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacaccatgcccgaactgcggcaaacctttgacaggcgatatggtcagatca
tcaaatgtgccttgtcaatttcgctgcggccactgccgggaacggctttatgaatataaa
gtttcagctccgattatgctggtatcattagcggccatcgtgctgcttatttatcttttg
atgctcctccgcaatgcggcaggctcagtgctgccagctgtacagcacgtgccgatggct
gtatttgcgcttgtgtgcgcgtatcccgtttttattgtgagtgagcggatgattgcaaag
tacgtgattcaaaatggcaacatcatttatagaggaaagagaaaaggctcctga

DBGET integrated database retrieval system