KEGG   Bacillus subtilis subsp. subtilis 168: BSU03981Help
Entry
BSU03981          CDS       T00010                                 

Gene name
mtlA
Definition
(RefSeq) PTS system-mannitol-specific transporter subunit EIICB
  KO
K02799  PTS system, mannitol-specific IIB component [EC:2.7.1.197]
K02800  PTS system, mannitol-specific IIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00051  Fructose and mannose metabolism
bsu01100  Metabolic pathways
bsu02060  Phosphotransferase system (PTS)
Module
bsu_M00274  PTS system, mannitol-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSU03981 (mtlA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU03981 (mtlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03981 (mtlA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     BSU03981 (mtlA)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component [MD:M00274]
    BSU03981 (mtlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_IIB
Motif
Other DBs
NCBI-GeneID: 938263
NCBI-ProteinID: NP_388280
UniProt: P42956
Position
449724..451160
Genome map
AA seq 478 aa AA seqDB search
MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIPAGWFPNEQLNTLVSP
MITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFLGAMIMGPLGGYLIKQT
DKLFKDKVKQGFEMLINNFTAGIVGAALTILAFYAIGPVVLTLNKLLAAGVEVIVHANLL
PVASVFVEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFLVEANPGPGLGILLAYMFF
GKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPALILAAIAGGASGLLTFTIFNAGLVAA
ASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVILKSSKASEEDLAAATEKMQSM
KGKKSQAAAALEAEQAKAEEASELSPESVNKIIFACDAGMGSSAMGASILRNKVKKAELD
ISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHISVDNFLNSPKYDELIEKLKK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcaagaacagcagcaaggcggcatgaaagtgaaagtgcaacgctttgggagt
tatttgagcggaatgatcatgccgaatatcggcgcgtttatcgcgtggggtatcattacc
gcgctgtttattccggcaggatggtttccgaatgaacagctgaacacgctggtcagcccg
atgattacgtatttattgccgcttttgatagcgtatacaggcggaaaaatgatctacgac
caccgcggcggagttgtcggagcgacagcggcaattggggtgattgtaggatcggatatt
ccaatgtttttaggcgcaatgattatgggtccgcttggcggatacctcattaaacagact
gataaattattcaaggataaagtcaagcaaggctttgaaatgctgatcaacaactttacg
gcagggattgtcggcgcggctttaacgattctcgcgttttacgccatcggcccggttgtc
ttgacgctaaataaattgctggcggctggtgtggaagtcattgtacacgctaatttactg
ccggtagccagtgtttttgtagaaccggcgaaagtgttgttccttaacaacgccataaac
catggaatcttaagcccgatcggaatcgagcaagcatctcaaacaggaaaatcaattctg
tttttagtagaagcaaaccctggaccggggctcggcattttgctggcctacatgttcttt
ggcaaaggatcttcaaaatcaacggctcccggtgcggcgatcatccatttcttcggaggg
attcacgagatttacttcccgtacattctgatgaaaccggccctgattctcgcagccatt
gccggcggagcaagcggactcttaacatttacgatctttaatgccggacttgtcgcggca
gcgtcaccgggaagcattatcgcattgatggcaatgacgccaagaggaggctatttcggc
gtattggcgggtgtattggtcgctgcagctgtatcgttcatcgtttcagcagtgatcctg
aaatcctctaaagctagtgaagaagacctggctgccgcaacagaaaaaatgcagtccatg
aaggggaagaaaagccaagcagcagctgctttagaggcggaacaagccaaagcagaagaa
gcgtctgagctgtctcctgaaagcgtgaacaaaattatctttgcgtgtgatgcgggaatg
ggatcaagtgccatgggggcatccatcttaagaaacaaagtgaaaaaagcggagcttgac
atcagtgtgaccaacacggccattaacaatctgccaagcgatgcggatattgtcatcacc
cacaaagatttaacagaccgcgcgaaagcaaagctgccgaacgcgacgcacatatcagtg
gataacttcttaaacagcccgaaatacgacgagctgattgaaaagctgaaaaagtaa

DBGET integrated database retrieval system