KEGG   Bacillus subtilis subsp. subtilis 168: BSU04070
Entry
BSU04070          CDS       T00010                                 

Symbol
ycsI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: D-Glu_cyclase DUF1495
Other DBs
NCBI-GeneID: 938647
NCBI-ProteinID: NP_388289
Pasteur: BG11230
BSORF: BG11230
UniProt: P42966 A0A6M3ZKQ4
Position
459049..459822
AA seq 257 aa
MAPKDVRALIREGKINGPTAGMSGGYAQANLVVLKKDLAFDFLLFCQRNQKPCPVLDVTE
AGSPVPSLAAPDADIRTDFPKYRIYRHGILTEEVSDITPYWEDDFVGFLIGCSFSFEQAL
INNGIAVRHIDEGTNVSMYKTNIDCVPAGAFHGQMVVSMRPVPERLAVRAAQVTSRFPAV
HGGPIHIGNPGAIGIRDLGKPDFGDAVSIRDGEVPVFWACGVTPQAVAMNVKPEMVITHA
PGHMLITDIRDESLAVL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcgccaaaggatgtacgcgccctgatacgagaggggaaaataaacgggccgaccgca
ggcatgtccggcggctacgcccaagcgaatcttgtggttttgaaaaaggaccttgcgttt
gattttctgctgttttgccagcgaaatcaaaagccctgccccgtgctggatgtgactgaa
gcaggttcgcctgtgccgtctctggctgcgccggatgctgatatcagaacggactttccg
aaataccgtatttacaggcacggtatcctaacggaagaagtatctgatattacgccatac
tgggaggacgattttgtcggctttctgatcggatgcagtttctcctttgaacaggcactg
atcaataatgggatagctgtccggcatattgatgaggggacaaacgtctcaatgtataaa
acgaatatcgattgtgttccggcgggggcgtttcacggacagatggttgtcagcatgagg
ccggttcctgaacggctggctgtacgtgctgcacaagtgacctcgcgttttccggctgtg
cacggagggccgatccatattggcaatccgggagcaatcgggattcgcgatctcgggaaa
ccggatttcggagatgccgtttccattcgtgacggcgaggttcctgttttttgggcatgc
ggagtgaccccgcaagccgtggctatgaatgtaaagcctgaaatggtcatcacacatgcg
ccggggcatatgctcatcacagatattcgagacgagtcgcttgcggtgctgtag

DBGET integrated database retrieval system