KEGG   Bacillus subtilis subsp. subtilis 168: BSU04080
Entry
BSU04080          CDS       T00010                                 

Symbol
kipI
Name
(RefSeq) kinase A inhibitor
  KO
K06351  inhibitor of KinA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU04080 (kipI)
SSDB
Motif
Pfam: CT_C_D
Other DBs
NCBI-GeneID: 938256
NCBI-ProteinID: NP_388290
Pasteur: BG11231
BSORF: BG11231
UniProt: P60495 A0A6M4JFJ7
Structure
Position
459867..460589
AA seq 240 aa
MTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPGFIECIPAFTSLTVFY
DMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNRRIVEIPVCYGGEFGPDLEEVA
KINQLSPEEVIDIHTNGEYVVYMLGFAPGFPFLGGMSKRIAAPRKSSPRPSIPAGSVGIA
GLQTGVYPISTPGGWQLIGKTPLALFRPQENPPTLLRAGDIVKFVRISEKDYHAYKEESN
NT seq 723 nt   +upstreamnt  +downstreamnt
atgactgtacgatatcaaatcgaacagctcggtgattctgcaatgatgatccgattcgga
gaagaaatcaatgaacaggtcaacggcattgtccatgcagcggccgcttatatagaagaa
cagccatttccgggattcattgaatgtatcccggcttttacaagtctaaccgtattttat
gatatgtatgaagtgtacaagcatttgcctcaaggcataagctcaccttttgagagtgtc
aagcgcgatgtcgaagagcggctggcagaaatagccgaagactatgaggtcaaccgccgt
attgtagaaattcccgtttgctatggcggtgaattcggtccggatttagaagaggtggcg
aagatcaatcaactgtcaccggaggaagtaatcgacattcatacaaacggtgaatatgtg
gtgtatatgcttggcttcgcgcccggttttccttttctaggcgggatgtcaaaacgcatt
gcagctccgagaaaatcatcgccaagaccgtcgattcccgcaggttcggtcggtattgcg
ggattgcagacaggcgtttatccgatttcaacgccgggcggctggcagctgatcggcaaa
acgccgctggctcttttccggccgcaggaaaacccgccgacattgctgcgggcgggagat
attgtgaaattcgttcgcatctcagaaaaagactatcacgcctataaggaggagtccaat
tga

DBGET integrated database retrieval system