KEGG   Bacillus subtilis subsp. subtilis 168: BSU04090Help
Entry
BSU04090          CDS       T00010                                 

Gene name
kipA
Definition
(RefSeq) kipi antagonist
  KO
K06350  antagonist of KipI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU04090 (kipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CT_A_B
Motif
Other DBs
NCBI-GeneID: 2914204
NCBI-ProteinID: YP_054571
Pasteur: BG14193
BSORF: BG14193
UniProt: Q7WY77
Position
460592..461599
Genome map
AA seq 335 aa AA seqDB search
MKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGNGENEAGLEITMMGPG
PSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENSTVSFGPCKLGSRAYLAAAGGI
EVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSALSQTILSRLSSQLGKQGFAAPK
WSVSRGRFLPLKKNPVIRVLEGKQFAFFTEESKTRFYEEAFRVTPQSDRMGYRLKGEPLE
LKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRIAHIISADLPIVSQIMPGEH
VQFEPVSLQEAEALAVEREQHIKELKTRMKMEWLT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattaaagcccggactgctcacaacggttcaggatataggcagaacgggttac
caaaaatacggcgttctggccagcggcgctatggacacggtttcactgcgcattgccaat
ctgttgataggaaacggcgaaaatgaagcaggtctcgaaataacgatgatggggcccggt
ccgtcgtttcatttttcaaaacagacactgattgctgtgacaggggcggacttcacgctg
cgtattaatgacgaggaagcgcctttatggaagcctgtgctcatcaaggaaaacagcacg
gtcagctttggcccctgcaaactcggcagccgtgcttatttggcggcagctggcggcatt
gaggtgcctgccgtcatggaaagtaaaagcacatacgtcagaggaagcattggcggactt
catggcagagcgcttcaaaaagaagatgaactgaacattggagagatgtcagctctttcg
caaaccatcctttctcgcttaagttcgcagcttggaaaacagggatttgcagcaccgaag
tggtcagtcagccgcggcagatttctgccattgaagaagaatcccgtcattcgggtgctg
gaaggaaagcaatttgcctttttcacagaagaatcaaaaacgcgtttttatgaagaagca
tttcgtgtcacgccgcagtccgaccgtatgggctacaggctcaaaggagaaccgctcgaa
ctgaaggccccgcttgagatggtgtcggaagcggtttcattcggaacagttcaggtgccg
cctgacggcaacccgattatcctgcttgcagaccggcagacgactggcggctatccgagg
atcgcgcacatcatatccgctgatcttccgattgtttcccaaatcatgccgggcgagcac
gttcagtttgagcctgtgtccctccaggaggcagaagcgcttgcggtagaacgggaacag
catataaaagaactgaaaacgagaatgaagatggaatggctgacatag

DBGET integrated database retrieval system