KEGG   Bacillus subtilis subsp. subtilis 168: BSU04110
Entry
BSU04110          CDS       T00010                                 
Symbol
lipC
Name
(RefSeq) spore germination lipase LipC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL
Other DBs
NCBI-GeneID: 938249
NCBI-ProteinID: NP_388292
Pasteur: BG11232
BSORF: BG11232
UniProt: P42969 A0A6M3Z7H6
Position
462431..463072
AA seq 213 aa
MVLRYTALGDSLTTGRGSGLFSPGFVQRFGDMMEADLKTRTAINIFARSGLNTEEILGLL
SYPYVQKCIRDADMITITGCGNDLIDSVLAYQTSKDETIFSRVSAHCHENFEKMIAKVAE
IKGENPSPYAIRVFNLYNPFPEIDIAGKWITSFNSHLETLASAPHVKIADAYSIFKGKEQ
EYLSFDGVHPNSKGYQAMAEAVHKLGYKELSVS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggtgcttcgatatacagctctgggcgattccttgacgacagggagaggctccgggctg
ttttcacccggcttcgtccagcgttttggggacatgatggaagctgacttgaaaacaaga
acggcaataaacatatttgccagatcaggtctgaatacagaagagattttgggactcctg
tcatatccctatgtgcaaaaatgtattcgagatgctgatatgataacgatcacagggtgc
ggaaacgatctcatcgattcggtcttagcctaccaaacctctaaggatgaaacgattttc
agccgtgtatccgcccattgccatgagaattttgaaaagatgattgccaaagtcgccgag
attaaaggagaaaatccttccccgtacgccattcgtgtgttcaacttatacaatccgttt
cccgaaattgatatcgccggcaaatggatcacttcgtttaattcacatttagaaacactt
gcatcagcaccccatgtcaaaatcgcggatgcctatagcatcttcaaaggcaaagaacag
gaatatctgtcctttgacggtgtccatccgaacagcaaaggctatcaagcgatggctgaa
gccgttcacaagctaggctataaagaattatcagtttcatag

DBGET integrated database retrieval system