KEGG   Bacillus subtilis subsp. subtilis 168: BSU04150
Entry
BSU04150          CDS       T00010                                 

Symbol
ycsN
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 936168
NCBI-ProteinID: NP_388296
Pasteur: BG11235
BSORF: BG11235
UniProt: P42972 A0A6M4JIK5
Position
466042..466944
AA seq 300 aa
MQRIQLAEDLQFSRVIHGLWRLNEWNYSDAELLSLIEWCIDHGITTFDHADIYGGYTCEK
LFGNALALSPGLRENIELVTKCGIVLESPERPAHRSHHYNTSKSHILASVEQSLMNLRTD
YIDMLLIHRPDPLMDPEGVAEAFQALKCSGKVRYFGVSNFKDHQYRMLESYLPEKLVTNQ
IELSAYELENMLDGTLNLCQEKRIPPMAWSPLAGGKVFTENTDKDRRVRTALESVQGEIG
AASLDEVMYAWLYTHPAGIMPIVGSGKRERISAAINALSYKLDQDQWFRIFTAVQGYDIP
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcagcgtattcaattggcggaggatcttcaattttcaagagtcatacacgggctttgg
cggctgaatgaatggaactattcagatgctgaacttctaagcctcattgaatggtgtatc
gatcacggcatcacgacctttgatcatgcggatatttatggaggctatacgtgcgaaaag
ctgtttggaaacgcccttgccctttcgcctggattaagagaaaacatagagttggtcaca
aaatgcggtatcgttcttgaatcgcctgaacggcccgctcacagatcgcatcattataac
acaagcaaatcgcatattttggcatccgttgagcaatcgcttatgaaccttaggacggat
tatatcgatatgcttttgattcacagaccggacccgctcatggatccggagggggtagca
gaggcgtttcaggccttgaaatgctctggcaaggtcaggtactttggcgtttcaaatttt
aaagatcaccagtatcggatgctggaatcatatttgcctgagaagctcgtaaccaaccag
attgagctttccgcatacgaattagaaaatatgctcgacggcactttgaacctgtgccag
gaaaaacggattccgccgatggcttggtcgcctctggcaggcggcaaagtattcactgaa
aacacggataaagaccgacgtgtccgtacggcgcttgaatccgtccaaggggaaatcggc
gccgcttcattggacgaggtgatgtacgcatggctgtatacgcatccggccggcatcatg
ccgattgtcggaagcggaaagcgcgagcggatttccgccgcgataaatgcgttgtcatac
aagcttgaccaggatcaatggttccgcatttttacagccgtacagggttacgatattcca
taa

DBGET integrated database retrieval system