KEGG   Bacillus subtilis subsp. subtilis 168: BSU04200Help
Entry
BSU04200          CDS       T00010                                 

Gene name
ydaE
Definition
(RefSeq) D-lyxose ketol-isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSU04200 (ydaE)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BSU04200 (ydaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Lyx_isomer ARD
Motif
Other DBs
NCBI-GeneID: 938182
NCBI-ProteinID: NP_388301
Pasteur: BG12053
BSORF: BG12053
UniProt: P96578
Structure
PDB: 

Position
472585..473088
Genome map
AA seq 167 aa AA seqDB search
MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVL
FPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHE
IELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcacgaaagaagaagtgaacagctactatcaaaaagcagggattgtattaacg
gacgaggaagtagaccaaatccagctgatggattacggcttaggaaaagaaagaaaagtc
gggctccagctcttcgtctacgtcaatacagaccgttattgttcaaaggaattggtgctg
tttccgggacagacttgcccggaacaccgccatccaccggtcgacggccaggaaggcaag
caggagaccttccgctgccgctacggaaaagtgtatctttacgtagaaggagaaaaaacg
ccgcttccaaaagttctccctcctcaggaagacagagaacactatacggtctggcacgaa
attgagctagaaccgggcgggcaatacacgattccaccaaacacaaagcattggttccag
gccggggaagaaggtgccgtcgtgacggaaatgtcatcgacgagcacggataaacatgat
atctttaccgatccaagaatataa

DBGET integrated database retrieval system