KEGG   Bacillus subtilis subsp. subtilis 168: BSU04260
Entry
BSU04260          CDS       T00010                                 
Symbol
topB
Name
(RefSeq) DNA topoisomerase 3
  KO
K03169  DNA topoisomerase III [EC:5.6.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU04260 (topB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     BSU04260 (topB)
DNA replication proteins [BR:bsu03032]
 Prokaryotic type
  DNA Topoisomerases
   BSU04260 (topB)
SSDB
Motif
Pfam: Topoisom_bac Toprim zf-ISL3 pXO2-72 ORC2 zf-C4_Topoisom Toprim_4 RNA_POL_M_15KD
Other DBs
NCBI-GeneID: 938247
NCBI-ProteinID: NP_388307
Pasteur: BG11979
BSORF: BG11979
UniProt: P96583 A0A6M3Z855
Position
476558..478741
AA seq 727 aa
MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHLVTLADPEGYGKEFQS
WRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIATDAGREGELVARWIIEK
ANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVARAEADWIVGINATRALTT
KFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVDGMTLTWQDKKSKQTRTFN
QDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQRDAHKRFGFSAKETLSVLQK
LYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQYVSQIKKRGIKSHKGYVNDA
KVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGETFT
AKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFN
EGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVATRADIIEKLFNSFLIEKKGQDIFI
TSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKLKSAVFIKDMKAYAHQTVKEIKNSS
QTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQDRECGSRKTIARKTNARCPNCHKRME
LRGQGEGQTFACVCGHREKLSVFEKRKNKDKARATKRDVSSYMKKQNKDEPINNALAEQL
KKLGLDK
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgtcaaaaacagttgtattagctgaaaaaccttcagtcggccgggatttagcccgggta
ctgaagtgccataaaaaaggaaacggttatctcgaaggcgatcaatatattgtgacttgg
gctttaggccatttggtgacgcttgctgatccggaaggctacggaaaagaatttcaatca
tggcgcctagaggatctgccgattatcccagaacccttgaagcttgtggtgataaaaaaa
accggaaagcagttcaatgcagtcaaatcccagcttacccgtaaagacgtcaatcagatt
gtcatcgcgactgacgcaggccgggaaggtgagcttgttgcgcgctggatcattgagaaa
gcgaatgtccgaaaaccaatcaagcggctgtggatttcatctgtgacggataaagcgatc
aaggaaggttttcaaaagctgcgcagcggcaaagaatatgaaaacctgtaccattctgcc
gtcgccagagcggaagcggattggattgtggggatcaacgccacccgtgcacttaccaca
aaattcaatgcccagctctcatgcgggcgtgtgcagactccgacgcttgccatgattgca
aagcgcgaggcagacattcaggcgtttacgcccgttccgtattacggcatacgtgctgca
gtcgacggcatgacgctgacgtggcaggataagaaatcaaagcagacgagaacgttcaat
caagatgtaacaagccgtttgctaaaaaatctccaaggaaagcaagcggtcgtagctgag
ctgaaaaaaacagcgaaaaaaagctttgcgcctgcgctttatgatttaacggagctccag
cgtgacgcccacaagcgcttcggtttttctgccaaagaaacgctttctgtcctgcagaag
ctatatgagcagcataagctcgtcacatatccgcggacggactctagatttttatccagt
gacatcgtcccgacgttaaaagaccgtctggaaggcatggaagtaaaaccgtatgcccaa
tatgtcagccaaattaaaaaacgcggcattaaatctcataaaggatatgtcaatgacgcg
aaggtgtcagaccaccacgcgattatcccgaccgaagagccgctcgttctcagcagtctg
agtgataaagaacgaaagctgtatgacctgattgcgaaacgtttcctggctgtattaatg
cctgcattcgaatatgaggaaacaaaggtcatcgcagaaatcggcggagaaacctttacg
gcgaaaggcaaaaccgtgcagtcgcaagggtggaaagccgtttatgatatggcggaagag
gatgatgagcaggaggatgacagagatcagacacttcctgcgcttcaaaaaggcgacaca
cttgccgtccgcacgttaacggaaacaagcggccaaacgaagccgcctgcccgctttaat
gaagggaccttgctgtcagcgatggaaaacccaagcgcgtttatgcagggagaagaaaaa
ggcctcgtcaaaacgcttggagaaacaggcggcctcggcacggtggcaacgcgtgccgac
attattgaaaaactgttcaacagctttttaatcgagaaaaaaggccaagatatttttatc
acatctaaaggaaaacagctcctgcagcttgttccggaggatctgaaatcaccggcctta
acagcagaatgggagcaaaagctgtctgcgatcgcggccggcaaattgaaatcggctgtt
tttattaaagatatgaaggcttacgctcaccaaacggtaaaagaaatcaaaaacagcagc
caaaccttccgacatgacaacattacgggaacggcatgtccggaatgcggcaaaatgatg
ctgaaagtaaacggcaaacgcgggacgatgctcgtgtgccaagatcgtgaatgcggaagc
agaaaaacgattgcccgaaaaacaaacgcacgctgcccaaattgccataaaagaatggag
cttcgcggccaaggcgagggccaaacctttgcgtgtgtgtgcggtcaccgtgaaaagctc
tctgtatttgaaaaacgaaaaaacaaagacaaagcgcgtgctaccaaacgggacgtatcc
tcttatatgaaaaaacaaaataaagatgagccgattaacaacgcgctggcagaacagctg
aaaaaactcggtttggataaataa

DBGET integrated database retrieval system