KEGG   Bacillus subtilis subsp. subtilis 168: BSU04280
Entry
BSU04280          CDS       T00010                                 

Symbol
ydaK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: GGDEF
Other DBs
NCBI-GeneID: 938240
NCBI-ProteinID: NP_388309
Pasteur: BG12058
BSORF: BG12058
UniProt: P96585 A0A6M3Z7J1
Position
480013..480864
AA seq 283 aa
MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFGVIAAGIWFGPIYALA
VTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFSFISGRIHDITAELRRS
MTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNSFVFLLLHMHYFKEFKSL
YGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHTPAEHMPAVLTKLKKQLDT
YQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMNEL
NT seq 852 nt   +upstreamnt  +downstreamnt
atgaaaatatcattcagtgaatcacaaaaattatttgcttatttttcagggctcatcgcg
gccctgtctttgtttatttattatgtgtcagcccagcaatcagaaggtgctctgatcctt
tgcatcacatttggcgtcatcgccgcaggcatctggttcggcccgatttacgcgctggca
gtgaccttaatcgtactctttgttctcggcaccttaatgatgtttttccagactggacag
acatcgctctttccggctgaggaagggctgcgaatgcttgtcgtgtggggaatcgcgctt
ttgctgttttcttttatttctggaagaatccacgatattacagcagagcttcggcgctca
atgacacggcttcaatccgaaattaaaagctatgttgctgttgacagagtgactggtttt
gataacaagcaaaggatgaagctggaactttcagaagaaatcaagcgggcggagcgctac
ggcaattcttttgtgtttttgctgctccatatgcattatttcaaagagtttaagtctttg
tacggtgaaaaagaaacggaccgcctcttccaatatgtcggtcagcaaatcaggacaagc
gttcgggaaacggataagaaattccgtccctctgacgagcgtatcgggatcgtgctgacg
cacacgcctgctgaacatatgccggccgttctgactaagctgaagaaacaattggataca
tatcagctggaaaatggaaagtatgtgtcgcttacgttccacgtttgctatttgccctac
cgcaacgatatccaaacagctgatcaatttttagaagaactggaaaacgagatgatgatg
aatgaactataa

DBGET integrated database retrieval system