KEGG   Bacillus subtilis subsp. subtilis 168: BSU04290
Entry
BSU04290          CDS       T00010                                 

Symbol
ydaL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2334
Other DBs
NCBI-GeneID: 938244
NCBI-ProteinID: NP_388310
Pasteur: BG12059
BSORF: BG12059
UniProt: O31487 A0A6M3ZI56
Position
480875..482584
AA seq 569 aa
MLCVMMLLFSAIASFPVSAQAKDQDAGILIIYSTLDGKESSQVKMLDLLAGHFTSHVTVK
KDSDVEASDFKGKDHVIYYGQTKRKLSQKLLSLISGVKKPVVAIGYNAGQISQFSGLSLA
RKENVFQVHSRSEKADVSLESGLNVLSVSGLKGTALYTFKADEGTTHSFIWKTKKGNVYI
GLTNLLNDNLIVAKQLREAFGEKAGTTLLYLRLEDISPMSDEKLLLQAGTYLHKRHIPFI
LAVIPVYLNPETGDKVYLSNQPKMVKVLKKLQSMGGSIIVHGYTHAYRYSETGEGFEFWD
AKADQPITSGNAEDPPSILEKEQDFPNEQAYHSYLEPFREKEETYTKQKLTRAIEDLTSS
GLYPLAFEAPHYTMSEYGYQIASQYFTSIFGQVQLSSTTWKTSGAPPFVTAPSMLHGMTL
YPETIGFVDTSKQNPLGEMEEHISQMIDFEGGVAGGFYHPYLGMKYLPELVDQMERIPDS
EWLDLKKTKQTVKTDKVEIHTSGDGTIQVKNGVSPIYEFFDHHRQTPLEKALWILSAVVL
LFVIMFVSYTFYLRATLKKRIFKERRSLG
NT seq 1710 nt   +upstreamnt  +downstreamnt
ttgctatgcgtcatgatgcttctattttcagctattgcgtcttttcccgtttctgcgcaa
gcgaaagatcaggatgccggcattctcatcatctactcaaccttggacggcaaagagtcg
tcacaagtcaaaatgctcgatttgcttgcgggccactttacatcccatgtgacagtcaaa
aaagattcagacgttgaagcgtcggatttcaaagggaaagaccatgtgatttattacggc
caaacgaaaagaaagctcagccaaaaattgctgtctcttatcagcggcgtgaaaaaaccg
gttgtcgccattggctataacgcaggccaaatcagccaattttctgggctttcattagcc
cgcaaagaaaatgtgtttcaggttcacagcaggtcagaaaaggccgatgtgtctctggaa
agcgggcttaacgtgctgagtgtatcaggcctgaaaggaacggcgctttacaccttcaaa
gcggatgaaggcacaacgcattcttttatatggaaaacaaaaaaagggaatgtgtacatt
ggattaacaaatttgttaaatgacaatttgatcgtggcgaaacagctcagagaagctttc
ggagagaaggcggggacgacgttattgtatttgcgtctcgaggatatcagcccgatgtct
gatgaaaaactgctgcttcaagccggtacatacctgcataagcggcatattccttttatc
ctggcggtcattccggtttacttgaatccggaaacaggcgacaaagtgtatttgtctaat
caaccgaagatggtcaaggtgctgaagaagctgcaaagcatgggcggcagtatcatagtt
cacggctatactcacgcttatcgctacagtgaaacaggagagggatttgaattttgggat
gcaaaggcggatcagccgattacatccggaaatgccgaagaccccccgtccattttggag
aaagaacaggacttcccgaacgaacaagcctatcacagctatcttgaaccatttcgggaa
aaggaagaaacgtatacaaaacaaaaactgacgcgtgccattgaggatttgacatcatcg
ggtctttacccgctggcgtttgaagcgccgcattacacgatgtccgaatatggctatcaa
atcgcctcgcagtattttacaagcattttcggccaggtccagctcagcagcacaacatgg
aaaacatccggtgcacctccgtttgtgactgctccttcgatgctgcacggaatgacgctt
tatccggaaacgatcggctttgtcgacacatcgaagcaaaacccgctcggtgagatggag
gagcatatctcccagatgattgattttgaaggcggagtagccggaggattttatcacccg
taccttgggatgaaatatctgcctgagctggttgatcagatggaacgcattccagacagt
gaatggcttgatttaaagaaaacgaaacaaaccgtcaaaacagacaaagtggaaattcat
acaagcggtgacggaacgattcaggtgaaaaacggcgtaagccccatttacgagtttttc
gatcatcaccggcaaacccctctggaaaaggcgttatggattctctccgctgttgtgctc
ttatttgtcatcatgtttgtcagttatacgttttacttgagagccacattgaaaaaacga
atttttaaggagagaagaagccttgggtaa

DBGET integrated database retrieval system