KEGG   Bacillus subtilis subsp. subtilis 168: BSU04300
Entry
BSU04300          CDS       T00010                                 

Symbol
ydaM
Name
(RefSeq) glycosyltransferase YdaM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Anp1
Other DBs
NCBI-GeneID: 939986
NCBI-ProteinID: NP_388311
Pasteur: BG12060
BSORF: BG12060
UniProt: P96587 A0A6M4JF43
Position
482577..483839
AA seq 420 aa
MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE
EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK
GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT
LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT
IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII
FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS
IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
NT seq 1263 nt   +upstreamnt  +downstreamnt
ttgggtaatacgctgttctttatctcgctaagtttaatatgggttatgcttctctaccac
atgttcctcatgcagggcgggtttcgccactatatgaccttcgaacggaatatcccgaag
tggagagaaaatatgaaggaactgccgaaggtcagcgtcctcatcccggcgcataacgaa
gaggttgtgattcggcagacgctgaaggccatggtcaacctttattatccgaaggaccgg
ctggagattatcgtcgttaatgataattcatcagaccggacgggtgatatcgtcaatgaa
ttttccgagaaatacgatttcatcaaaatggtgattacgaagccgccaaatgcaggaaaa
ggaaaatcctctgcacttaactcgggttttgccgaatcgaacggcgatgtgatctgtgtg
tatgacgccgacaacacgcctgagaaaatggccgtgtattacctcgtgctcggcctgatg
aatgacgaaaaggcaggcgccgtggtagggaaattccgcgtcatcaatgcggcaaagacg
ctgctgacgaggtttattaatatcgaaacgatctgttttcagtggatggcccagggaggc
agatggaagtggttcaaaatcgccacgatcccaggcaccaacttcgcgatccgcagaagc
attatcgaaaagctcggaggctgggatgacaaagcgctcgctgaggatactgagctgacc
atccgggtatataatctcggctatcacatccgctttttccctgccgccatcacgtgggag
caggaaccggaaacatggaaggtatggtggcgccagcgcacccgatgggcgcgcggcaat
caatatgtcgtgctcaaatttttggcgcagttttttaagctgaaacgaaaacggattatc
tttgatttgttttattttttctttacgtacttcctgtttttctttggcgtgatcatgtca
aatgcgatttttgtagtgaatttgttttatgatttgcatttgtctgttggatttttggca
atgattctctggattttggcgtttttcttatttatgacagaggtcatgattacgttgagc
attgaaaaaacagaaatgaacaagcaaaacttttttatcgtatttctcatgtacttcaca
tactcgcaggcatggattgtgcttgttatctactctttattcgtagaaatcaagcaccgt
ttattcaagcaagaggtcaaatggtacaagacagaacgatacaatcaacataaaagcggg
tga

DBGET integrated database retrieval system