KEGG   Bacillus subtilis subsp. subtilis 168: BSU04300Help
Entry
BSU04300          CDS       T00010                                 

Gene name
ydaM
Definition
(RefSeq) glycosyltransferase YdaM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tranf_2_3 Glycos_transf_2 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 939986
NCBI-ProteinID: NP_388311
Pasteur: BG12060
BSORF: BG12060
UniProt: P96587
Position
482577..483839
Genome map
AA seq 420 aa AA seqDB search
MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENMKELPKVSVLIPAHNE
EVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEKYDFIKMVITKPPNAGK
GKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDEKAGAVVGKFRVINAAKT
LLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSIIEKLGGWDDKALAEDTELT
IRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQYVVLKFLAQFFKLKRKRII
FDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLAMILWILAFFLFMTEVMITLS
IEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKHRLFKQEVKWYKTERYNQHKSG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgggtaatacgctgttctttatctcgctaagtttaatatgggttatgcttctctaccac
atgttcctcatgcagggcgggtttcgccactatatgaccttcgaacggaatatcccgaag
tggagagaaaatatgaaggaactgccgaaggtcagcgtcctcatcccggcgcataacgaa
gaggttgtgattcggcagacgctgaaggccatggtcaacctttattatccgaaggaccgg
ctggagattatcgtcgttaatgataattcatcagaccggacgggtgatatcgtcaatgaa
ttttccgagaaatacgatttcatcaaaatggtgattacgaagccgccaaatgcaggaaaa
ggaaaatcctctgcacttaactcgggttttgccgaatcgaacggcgatgtgatctgtgtg
tatgacgccgacaacacgcctgagaaaatggccgtgtattacctcgtgctcggcctgatg
aatgacgaaaaggcaggcgccgtggtagggaaattccgcgtcatcaatgcggcaaagacg
ctgctgacgaggtttattaatatcgaaacgatctgttttcagtggatggcccagggaggc
agatggaagtggttcaaaatcgccacgatcccaggcaccaacttcgcgatccgcagaagc
attatcgaaaagctcggaggctgggatgacaaagcgctcgctgaggatactgagctgacc
atccgggtatataatctcggctatcacatccgctttttccctgccgccatcacgtgggag
caggaaccggaaacatggaaggtatggtggcgccagcgcacccgatgggcgcgcggcaat
caatatgtcgtgctcaaatttttggcgcagttttttaagctgaaacgaaaacggattatc
tttgatttgttttattttttctttacgtacttcctgtttttctttggcgtgatcatgtca
aatgcgatttttgtagtgaatttgttttatgatttgcatttgtctgttggatttttggca
atgattctctggattttggcgtttttcttatttatgacagaggtcatgattacgttgagc
attgaaaaaacagaaatgaacaagcaaaacttttttatcgtatttctcatgtacttcaca
tactcgcaggcatggattgtgcttgttatctactctttattcgtagaaatcaagcaccgt
ttattcaagcaagaggtcaaatggtacaagacagaacgatacaatcaacataaaagcggg
tga

DBGET integrated database retrieval system