KEGG   Bacillus subtilis subsp. subtilis 168: BSU04320
Entry
BSU04320          CDS       T00010                                 

Symbol
ydaO
Name
(RefSeq) amino acid permease YdaO
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AA_permease_2
Other DBs
NCBI-GeneID: 938237
NCBI-ProteinID: NP_388313
Pasteur: BG12062
BSORF: BG12062
UniProt: P96589 A0A6M3Z7K9
Structure
Position
486432..488255
AA seq 607 aa
MYHSIKRFLIGKPLKSQAAGEQKLTKLKALAMLSSDALSSVAYGTEQILIILATISAAAF
WYSIPIAVGVLILLLALILSYRQIIYAYPQGGGAYIVSKENLGEKPGLIAGGSLLVDYIL
TVAVSISAGTDAITSAFPALHDYHVPIAIFLVLVIMILNLRGLSESASILAYPVYLFVVA
LLVLIAVGLFKLMTGQIDQPAHHTSLGTPVAGITLFLLLKAFSSGCSALTGVEAISNAIP
AFKNPPARNAARTLAMMGILLAILFSGITVLAYGYGTAPKPDETVVSQIASETFGRNVFY
YVIQGVTSLILVLAANTGFSAFPQLAFNLARDQYMPRMFTVRGDRLGFSNGIIFLGFASI
VLIILFGGQTEHLIPLYAVGVFIPFTLSQTGMCMKWIKQKPKGWIGKMLINSCGALISFM
VLSILFVTKFNVVWPVLIFMPIVVLLFFAIKNHYTAVGEQLRIVDKEPEEIKGTVVIVPV
AGVTTVVQKSIHYAKSLSDQVIAVHVSFDREQEKKFEKRWEELNNGVRLVTLHSSYRSLV
HPFDKFLETVEAKAKKEQFSVMVLFPQFITKKRWHTILHNQSAFLLRVRLFWKKDIMVAT
LPYHFKK
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtatcattcaatcaaacgttttttgattgggaaaccactaaaatcccaagcagctgga
gagcaaaaactgacgaaattaaaagccttggctatgctttcctcagatgcgctgtcatct
gtcgcatatgggacagaacaaattctaatcattttggcaacaatcagtgcagccgcattt
tggtactccattccgattgcggttggcgttctcatcttgctgctcgcactgattctttca
tacaggcaaattatttacgcttatccgcagggcggcggggcgtatatcgtttctaaagaa
aatctcggtgaaaaaccgggattgattgcgggcggttcattgcttgttgattatatttta
acagtagcggtaagtatttccgcaggcacggatgccatcacgtcagcctttcctgcattg
catgattatcatgtgccgatcgctatttttctcgtgttagtgattatgattttgaacctg
cgcgggctttcggaatcagcatccatacttgcctacccggtttatctgtttgtggtggcg
cttttggttctcattgcagtcgggttgtttaaacttatgacaggacaaatagaccagcca
gcccatcatacatcgctcggcacacctgtagccggcattacgctatttttgctgcttaag
gctttttcctccggatgctcagcgttgaccggggttgaggccatttctaatgcgattcct
gcattcaaaaacccgcctgcgcgaaacgcggcaagaacgcttgcgatgatggggattttg
ctggcgattctgttttccggcatcacggttctcgcgtacgggtatggtacggcgccgaaa
cctgatgaaacagtggtttcacaaattgcgtccgaaacctttgggcggaatgtgttctac
tatgtcatccaaggtgtcacatcgcttattttggttcttgcggcaaatacgggattctca
gccttcccgcagcttgccttcaacctggcgagagaccagtatatgccgcgaatgtttaca
gtcaggggcgaccgcttaggcttctcaaatgggattatctttttaggctttgcctccatt
gttctcattatcttattcgggggacagacggagcacttaatcccgttatatgctgtgggc
gtatttattccatttacgctttcacaaaccggcatgtgcatgaaatggatcaagcaaaaa
ccaaaaggctggatcggaaaaatgctgatcaactcctgcggcgctctgatatcatttatg
gttctatccattctgtttgtgacgaagtttaatgtcgtatggcctgtgttaatctttatg
cctatcgtcgttttgctgttttttgcgattaaaaatcactatactgcggttggtgaacag
cttcgcatcgtagacaaagagccggaagaaatcaaaggcaccgttgtgattgtgcctgtg
gccggtgtcaccaccgtcgtgcaaaaatcgattcactatgcgaaatcactgtccgatcag
gtgatcgccgttcacgtgtcatttgacagagaacaggaaaagaaattcgaaaaacgttgg
gaagagcttaataacggagtgcgtctcgtgacgcttcactcctcttacagaagccttgtc
catccgtttgataagtttttggaaacagttgaggcaaaagcgaagaaggagcagttttcc
gttatggtgctgtttccgcaatttataacgaaaaaacgctggcacaccatccttcacaac
caatcggccttcctcctcagagtccggctgttctggaaaaaggacataatggttgccaca
ctgccgtatcattttaaaaagtaa

DBGET integrated database retrieval system