KEGG   Bacillus subtilis subsp. subtilis 168: BSU04330
Entry
BSU04330          CDS       T00010                                 
Symbol
mutT
Name
(RefSeq) 8-oxo-dGTP diphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU04330 (mutT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BSU04330 (mutT)
DNA repair and recombination proteins [BR:bsu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BSU04330 (mutT)
 Prokaryotic type
    BSU04330 (mutT)
SSDB
Motif
Pfam: NUDIX NUDIX_4
Other DBs
NCBI-GeneID: 938242
NCBI-ProteinID: NP_388314
Pasteur: BG11956
BSORF: BG11956
UniProt: P96590 A0A6M4JFJ5
Position
488314..488763
AA seq 149 aa
MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAAVREILEETGYNAALS
AKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGRLPLFMVPNRKRQINDF
KNGAQDVNVTVKDSGLLAAIDLLKRRLGK
NT seq 450 nt   +upstreamnt  +downstreamnt
gtgtatacacaaggtgcttttgtgatcgtattgaacgaaagtcagcaaattctgctggtg
aaacgaaaagatgtccctctatgggatttgccgggcggcagggttgatcccggggaatcg
gctgaggaagcggcagtgcgggagatattggaagaaacgggatacaatgcagcgctttct
gcgaaaataggtgtttaccaaaggccaaagtttcaagatgaacagcatctgtttttcgga
agcattacaggcggacaagcaatggctgacggcacagagacagcgggattaaagtgggtt
tccccggggcgtttgccgctttttatggtgccgaatcgaaaaaggcagatcaatgatttc
aagaacggcgctcaagatgtaaatgtcaccgtcaaggatagcgggttgctcgcggcgatc
gacctgttgaaaagaagactgggcaagtga

DBGET integrated database retrieval system