KEGG   Bacillus subtilis subsp. subtilis 168: BSU04359
Entry
BSU04359          CDS       T00010                                 

Symbol
ydzK
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PGG DUF4231 DUF6713
Other DBs
NCBI-GeneID: 8302999
NCBI-ProteinID: YP_003097680
UniProt: C0H3V4 A0A6M4JGH9
Position
complement(490777..491043)
AA seq 88 aa
MSVFILFYLWIVPIVIGILCSVAAHKSKGKMRVAPGIAMIVLSIISLITAFTAGHTNFHV
FIGGMFLFGTFLVGSAFPFFFGLKKKEK
NT seq 267 nt   +upstreamnt  +downstreamnt
atgtcagtatttattctgttttatttgtggattgttcctattgttatcggcattttatgt
tctgttgctgcccataaatccaagggaaaaatgagagtcgcgcccggcattgccatgatc
gtgctcagtatcatttccctaatcacggcgtttacggccggacacacaaatttccacgtg
tttatcggcggcatgtttttattcggcaccttcttggtcggttctgcttttcctttcttc
ttcgggctgaagaaaaaagaaaaataa

DBGET integrated database retrieval system