KEGG   Bacillus subtilis subsp. subtilis 168: BSU04360
Entry
BSU04360          CDS       T00010                                 
Symbol
mntH
Name
(RefSeq) divalent metal cation transporter MntH
  KO
K03322  manganese transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU04360 (mntH)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU04360 (mntH)
SSDB
Motif
Pfam: Nramp DUF5883
Other DBs
NCBI-GeneID: 938241
NCBI-ProteinID: NP_388317
Pasteur: BG12065
BSORF: BG12065
UniProt: P96593 A0A6M4JDE8
Position
complement(491147..492424)
AA seq 425 aa
MMNKDITAQSPRSKAVQDALDGKIRGFRGLLPFLGPAFIAAIAYIDPGNFATNISAGSKY
GYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKPVSIGLWIQGELVIIAT
DLAEFIGAALGLYLLFGIPMLEASIIAAIGSFAILELQRRGYRSLEAGIAGMLFVVVIAF
ALQTFFAKPDAVSVMKGLFVPAFHGTDSVLLAAGILGATVMPHAIYLHSALTQRRVVGKT
DAERKKIFRFEFIDILIAMLIAGAINASMLIVAAALFFKNGLFVEDLDVAFQQFGHLVSP
MSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLYVRRFITIIPPILIIASGVNP
TTALVLSQVVLSFGIAFALIPLIMFTSNKRIMGSLINAKWITVVSWLIAVLIVALNVFLI
VDTFR
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgatgaacaaggacatcacagcacaatctccccgttccaaagccgtccaagatgcgctt
gacgggaaaatcagaggattcagagggctgctcccttttctcggccctgcatttatagca
gccattgcctatattgatcccggcaacttcgcaacgaatatttcggcgggttctaaatac
ggatatatgctcttatgggtgatcttattttccaatatcatggcgcttttaattcaatcc
ctatccgccaaactcggtattgcgacaggcaaaaatctgcctgaggttgcccgtgaagaa
ttcccgaagcctgtctcgatcggattatggattcagggcgagttggtcattatcgcaact
gatctggcggaatttatcggagcggctctgggactgtatttgctgttcggcattccgatg
cttgaagcgtctattattgcggcgatcggttctttcgcgatattggagcttcagcgccgt
ggttatcgctcacttgaagcaggtattgccggtatgctgtttgtggtcgtgatcgccttt
gcgttgcagacctttttcgcaaagcctgatgccgtgtcagtgatgaagggcctttttgtc
ccggcgtttcatggcaccgacagtgtgcttcttgcagcgggtattcttggcgcaactgtt
atgccgcacgccatttatttacactctgcccttacacagcggcgggtggttggcaaaact
gatgcagaacggaaaaaaatctttaggtttgaatttattgatattttaatagcgatgctg
attgcaggggctattaatgcaagtatgctgattgtggctgccgcattattcttcaaaaac
ggcctgtttgttgaggatctcgacgtcgcatttcagcaattcggacatcttgtcagccct
atgtctgcggctttgttcgggatcgggctgctcgttgccggtctatccagttcgtctgtc
ggcacactttcaggcgacgtgattatgcaaggatttatcaactaccgcattccgctgtat
gtacggcgttttatcacgatcattccgccgatcttgatcatcgcgtcaggtgttaatccg
acgaccgctctcgtactgagccaggtcgtgctgtccttcgggatcgcctttgccctcatt
ccgcttattatgtttacaagcaataaacggatcatgggatctctgatcaacgccaaatgg
atcacagtggtgtcttggctgattgctgtattgatcgttgctttgaatgtgtttttaatt
gtagatacgtttcgataa

DBGET integrated database retrieval system