KEGG   Bacillus subtilis subsp. subtilis 168: BSU04370
Entry
BSU04370          CDS       T00010                                 

Symbol
ydaS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Transgly_assoc Mpo1-like
Other DBs
NCBI-GeneID: 938230
NCBI-ProteinID: NP_388318
Pasteur: BG12066
BSORF: BG12066
UniProt: P96594 A0A6M4JK71
Position
complement(492654..492911)
AA seq 85 aa
MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGHGLLGTWGPSLAGFAI
FPAIIGAAIFVFLLGLIFRGLRKEA
NT seq 258 nt   +upstreamnt  +downstreamnt
atgcttagctttttggtttcattagttgttgcaattgttatcggattaattgggagcgcc
attgtaggaaaccggctgccgggaggaattttcggctctatgattgccgggctgatcggc
gcttggattgggcacggacttcttggcacatggggaccgagcctcgccggctttgctatt
ttcccggccatcatcggggcagccatcttcgtgttcttgctgggccttatattccgcggg
ctgcggaaggaagcctag

DBGET integrated database retrieval system