KEGG   Bacillus subtilis subsp. subtilis 168: BSU04380
Entry
BSU04380          CDS       T00010                                 

Symbol
ydaT
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2188 DNA_pol3_chi
Other DBs
NCBI-GeneID: 939950
NCBI-ProteinID: NP_388319
Pasteur: BG12067
BSORF: BG12067
UniProt: P96595 A0A6M4JIM6
Position
complement(492989..493441)
AA seq 150 aa
MPWSMKDYPASLKNLEKPVRKKAIDIANAMIDEGYEEGRAIPIATSKAKEWAENASTDEI
DDFLTHDDETERDADPSSGSGPELMNKAEHVIKHKKGWAVKAEGAKRVSEIKDTKKEAIE
RAKEIAAHKGTEVIVHLADGSVQRKIKTGS
NT seq 453 nt   +upstreamnt  +downstreamnt
atgccttggtcgatgaaggattatcctgcttcattaaaaaatcttgagaagccggtgaga
aaaaaggcgatagacattgcgaatgcgatgattgatgaaggctatgaggaagggcgcgcg
attccaattgcgacaagcaaagcgaaggaatgggcggaaaacgcctctacagatgaaatt
gatgatttcctgacgcatgatgatgagacagaacgcgatgctgatccaagcagcggcagc
ggccccgagctcatgaataaagcagagcatgttattaagcataaaaaaggctgggcagtc
aaagccgagggcgccaaacgtgtgtctgaaatcaaggatacaaagaaagaagcgattgaa
cgggcaaaggaaatcgcggcgcataaaggcactgaggtcattgttcatttagctgacggc
agtgtgcagagaaagattaaaacaggatcataa

DBGET integrated database retrieval system