KEGG   Bacillus subtilis subsp. subtilis 168: BSU04390
Entry
BSU04390          CDS       T00010                                 

Symbol
ydbA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: EcsC DUF4112 23S_rRNA_IVP
Other DBs
NCBI-GeneID: 938238
NCBI-ProteinID: NP_388320
Pasteur: BG12068
BSORF: BG12068
UniProt: P96596 A0A6M4JD11
Position
493559..494377
AA seq 272 aa
MPTERKEDLHQQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTPEFIQKKIGKLLDEVG
SFVQTGGQYLTSEKQIIRMFQKKLPEEIFESLEDIRKAPLPVMDEIAEGMGKNRTNAATV
QGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKKERVFIVKCLQLTSADVV
GKRSILQELKHYDQDRTYKNVASQIQGWREVVLGYRDTFGWKKLFQIVPVAGMVFGAAAN
RSTLNDITETGMMLYKKRRILERLKETEREME
NT seq 819 nt   +upstreamnt  +downstreamnt
gtgccaacagaacgaaaagaagacttacatcagcaattaaaagagatagagaaatgggaa
aaagatcagcaaaaagtctggttttgggaaaagctcagccgtctcccgtttcaactcctg
gacaagctgacaccagaattcatccagaaaaagatcggcaagctcttggatgaggtcggc
agctttgttcaaacaggcggacagtacctgacatctgaaaaacagattatcaggatgttt
caaaagaaactgccggaggagatctttgaatcgctggaggacatccggaaagcgcctctt
cctgtcatggatgaaattgcggaaggaatgggcaaaaacagaaccaacgcagcaaccgtt
caaggcgcgacaaccggtgtgggcggcgtgtttacgctggcggcagacattccggcagtg
cttggcttatcactaaaaacattacaggatatcgcagtcgcatacggctatgacccaaag
gagaaaaaagaacgagtcttcattgtgaaatgcctgcagcttacgtcggctgatgttgtc
ggcaaaagatcgattttgcaggaattaaaacactacgatcaagaccgtacatataagaat
gtcgcttctcaaatccaaggctggcgagaagtcgttttgggctatcgagacacgtttggc
tggaaaaaacttttccagatagtgccggttgccggaatggtttttggcgccgctgccaat
cgctcaacattaaacgacattaccgagacaggcatgatgctgtacaaaaagaggcgcatt
cttgaacgactgaaagaaacagaacgagagatggaatag

DBGET integrated database retrieval system