KEGG   Bacillus subtilis subsp. subtilis 168: BSU04400
Entry
BSU04400          CDS       T00010                                 

Gene name
gsiB
Definition
(RefSeq) glucose starvation-inducible protein B
  KO
K06884  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU04400 (gsiB)
SSDB
Motif
Pfam: KGG LEA_5
Other DBs
NCBI-GeneID: 938235
NCBI-ProteinID: NP_388321
Pasteur: BG10826
BSORF: BG10826
UniProt: P26907 A0A6M3Z826
Position
494506..494877
AA seq 123 aa
MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHDKEFYQEIGEKGGEAT
SKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNHDKEFYQEIGSKGGNAR
NND
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcagacaataacaaaatgagcagagaagaagcaggtagaaaaggcggagaaacaaca
agcaagaaccatgacaaagaattctatcaagagattggtcaaaaaggcggagaagccact
agcaaaaaccatgacaaagaattctatcaggaaatcggcgaaaaaggcggagaagccact
agcaagaaccatgacaaagagttctatcaagaaatcggtgaaaaaggcggagaagccact
agcgaaaatcatgacaaagaattctatcaagaaatcggccgaaaaggcggagaggcaaca
agcaaaaatcatgataaagaattctaccaagaaattggctcaaaaggcggaaacgcccgc
aacaacgactaa

DBGET integrated database retrieval system