KEGG   Bacillus subtilis subsp. subtilis 168: BSU04410
Entry
BSU04410          CDS       T00010                                 

Symbol
ydbB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cupin_2 Cupin_3 MannoseP_isomer AraC_binding 3-HAO Cupin_1 EutQ JmjC_2 Cupin_6 Cupin_7
Other DBs
NCBI-GeneID: 935969
NCBI-ProteinID: NP_388322
Pasteur: BG12069
BSORF: BG12069
UniProt: P96597 A0A6M3Z7K2
Position
495009..495350
AA seq 113 aa
MSKMQNLLAIANEVKEKHANFSISEVNDHCVRLAVFTGEYDWHHHPDSDELFIVLEGELL
IDFKDKETAVLKANDSLLIPKGTVHRTRSYVRTVNLCVEHKQAETVIIEEQPC
NT seq 342 nt   +upstreamnt  +downstreamnt
atgtccaagatgcaaaacttgctcgccatcgcaaatgaagtcaaagaaaagcacgccaat
ttttcaatctcagaggtcaacgaccactgcgtgcgccttgcggtgtttacgggagaatat
gactggcaccatcaccctgactcagacgaattgtttattgttcttgaaggggagctgctg
atcgattttaaggacaaagaaaccgcggtgctcaaagcaaatgacagcctgctgatccct
aaaggcacggttcaccgcacacgctcttacgtcagaacggtaaatctctgtgtggagcat
aaacaagccgaaaccgtcatcatagaggagcagccatgctaa

DBGET integrated database retrieval system