KEGG   Bacillus subtilis subsp. subtilis 168: BSU04420
Entry
BSU04420          CDS       T00010                                 
Symbol
ydbC
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4937
Other DBs
NCBI-GeneID: 938234
NCBI-ProteinID: NP_388323
Pasteur: BG12070
BSORF: BG12070
UniProt: P96598 A0A6M3Z7K4
Position
495344..495703
AA seq 119 aa
MLIKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKTIDEPLTAEIISVWENR
EAYDHFMENEHDSIYEENDQKAVILSIEVTVYEEDKPFVHDLLHNPDIRYEPNWTVLKA
NT seq 360 nt   +upstreamnt  +downstreamnt
atgctaatcaaaaagatgatatgtgaagtagatgctgcaaacgctgaagcatttgcaaaa
gcgcagtcacagtgggaagcgttatcgcatataagcggctttatcaaacaggccggcggc
tggcgaaaaacgatagacgagccgctcaccgcagaaatcatcagtgtatgggaaaacaga
gaagcctatgatcattttatggagaacgaacatgacagcatatacgaggaaaacgatcag
aaggctgtaattctttcgatagaggtgacggtgtacgaagaggataaaccgttcgttcac
gatctgttacataaccccgatatccggtacgaaccaaactggacggttctgaaggcataa

DBGET integrated database retrieval system