KEGG   Bacillus subtilis subsp. subtilis 168: BSU04430
Entry
BSU04430          CDS       T00010                                 

Symbol
ydbD
Name
(RefSeq) manganese catalase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Mn_catalase Ferritin Rubrerythrin
Other DBs
NCBI-GeneID: 938232
NCBI-ProteinID: NP_388324
Pasteur: BG12071
BSORF: BG12071
UniProt: P80878 A0A6M3Z7P4
Position
complement(495740..496561)
AA seq 273 aa
MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQGWNTRGNEKYKDLLM
DTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGGMNPHHAIVSGLGAMPE
SSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMTDDKGVKDMLSFLLARDT
MHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFSEGEVSAEQNWLNEKAPDG
EAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtttaagcacacaaaaatgctgcagcatcctgctaaaccagatcgtccagatccatta
ttcgctaaaaaaatgcaagaaattttaggcgggcaattcggagaaatttcagttgccatg
cagtacttatttcaaggctggaacacaagaggaaatgaaaaatacaaggacttgctgatg
gatacggcaactgaggagctcgggcatgttgaaatgatcgcaacgatgattgccagactt
cttgaggatgcccctcttgatcagcaggaaaaagctgctgaagatccggtcatcggctcc
atcctaggcggcatgaaccctcaccatgcgattgtatcaggacttggcgccatgccggaa
agcagtacaggcgtaccttggagcggcggttatatcgtagcaagcggaaacctgctggca
gacttccgcgccaacctgaatgcggaatctcagggccgtctgcaggtcgcacgcctgttt
gaaatgacggatgacaaaggcgtcaaagatatgctcagcttcctgctggcgcgtgacacg
atgcaccagaaccaatggctcgccgccattaaagaattagaagcacaggaaggtccggtt
gtgccgggtacattcccgaaagcgctcgaaaaacaagagttctcacatcagcttatcaat
ttctctgaaggcgaagtaagcgccgagcaaaactggctgaatgaaaaagcgccggacgga
gaagcctttgaatatgtgaaagaagcaaaaacgtttggagaaaaaccggagttaaaacca
gcaccgccttttgttcataatacacttccgggacgcgagtaa

DBGET integrated database retrieval system