KEGG   Bacillus subtilis subsp. subtilis 168: BSU04440
Entry
BSU04440          CDS       T00010                                 

Symbol
dctB
Name
(RefSeq) C4-dicarboxylate-binding protein DctB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DctP Rota_NS53
Other DBs
NCBI-GeneID: 938226
NCBI-ProteinID: NP_388325
Pasteur: BG12072
BSORF: BG12072
UniProt: P96600 A0A6M4JFB3
Position
complement(496646..497698)
AA seq 350 aa
MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQIVFKFSHVVAENTPKG
LAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQFIAPSTSKLGMLSPEW
GVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWTNGFKQITTNQGPVKTPD
DLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNVVDGEENTISNIYSKKFYN
VQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKETTEWNETYAEQMNKEQLEE
IKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELIRELLELRKDS
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaagagtttgcttgcatgtctcgcactgatgatcgctggaattgcaaccgctttattt
atcggattccatgatcataccggcaataaaaagattgtttatgatgacgaccaggaaggc
ctgcaggatcaaatcgtgtttaaattcagccacgtggttgctgaaaatacgccaaaaggg
ctggccgccaataaattcgctgatctggtgaacgaaaaatcaggcggaaaaataaaaata
gaagtatttccgaatggaagcctgtactcggacattgaagaaattgaagcattgcaaaac
ggcgatgttcaatttatcgccccctccacatcgaagctcggcatgctctcgcctgaatgg
ggagtgctggatctgccgtatgcatttacagattacaacgccgtcaaaaaagggctgaac
ggaagcatcggcacacagctgtttgattctctaaagaaaaaccaattgaaaggattggcc
tattggacgaacggctttaagcaaatcacaacaaatcaagggccggtcaaaacaccggat
gacttaaaagggcaggatctgcgcattatgcaaagcgatgtgattgaggatcagttcaag
ctgcttggcgcaacacctcatcaggaatccttcaattctacctttcagctgttagaaaac
aatgtagtcgatggcgaagaaaatacaatttcaaacatctattctaaaaaattttataat
gttcaggactatttgacaataagcagccacggttatctcggctacgctgtcatgactgat
gaacacttctggaaggcgcaaacaccagaaacaagacgcattttgactgaagcgatgaag
gagacaacggagtggaatgaaacgtatgccgaacaaatgaacaaggagcagctggaagaa
atcaaaaagaattctgctatacatatttatgagctgtcagataaagagaaacaagaatgg
atgaagcgtcttgaccctgtttaccggcagtatgagcccatctttggccgggagctgatc
cgggaactgttggagctgcgaaaagattcatag

DBGET integrated database retrieval system