KEGG   Bacillus subtilis subsp. subtilis 168: BSU04470
Entry
BSU04470          CDS       T00010                                 

Symbol
dctP
Name
(RefSeq) C4-dicarboxylate transport protein
  KO
K11103  aerobic C4-dicarboxylate transport protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU04470 (dctP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU04470 (dctP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU04470 (dctP)
SSDB
Motif
Pfam: SDF
Other DBs
NCBI-GeneID: 938223
NCBI-ProteinID: NP_388328
Pasteur: BG12075
BSORF: BG12075
UniProt: P96603 A0A6M3Z7T9
Position
500166..501431
AA seq 421 aa
MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKMVIAPIIFFTIVLGIA
KMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLDYSKLEKGDVSQYTQNG
GQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAALGEKGKSVIDFFDKVSH
VFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMSVYITMFLFVFVALNIICK
LYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYGCSKSVVGLVIPTGYSFNLD
GTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGAAGVTGSGFIVLASTLSALQV
IPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSENEFDEAKSIEAVEGMKKMKTA
V
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaaactgtttaaaaatttaacagttcaggtcataaccgcggtcatcatcggggtcatt
gtcgggctggtctggccggatgtcggcaaagaaatgaaaccgcttggtgatacatttatc
aacgctgttaaaatggtgatcgcaccaatcattttcttcacaatcgttctcgggattgca
aaaatgggcgatatgaagaaggttggaaaagtagggggaaaagcgtttatctatttcgag
gttgtcaccaccctcgcactcattatcggtttatttgtcgtcaatattatgaagccgggt
gcgggtcttgattacagcaagcttgaaaaaggagatgtatcacaatacacgcaaaatggc
ggtcagggaatcgactggattgaatttattacacacattgttccgtccaacatggttgat
gccttcgcaaaaggggacattttgcaggtcttattcttttctattcttttcggagtgggt
cttgcggcattaggcgaaaaaggaaaaagcgtcattgatttcttcgacaaggtttctcac
gtttttttcaaaattatcggctacattatgcgtgccgcgccaatcggggcattcggggcg
atggcgtatacaatcggacacttcgggctcgattccatcaaaccgctggcaagcttaatg
atgtctgtttatattacgatgttcctgttcgtatttgttgctttaaatatcatctgcaag
ctttacggattcagcctgtggaattaccttcgcttcattaaggatgagcttttgatcgtg
cttggcacaagctcttccgaatcggtgcttccgcgtatgatggataaaatggagcgctac
ggctgttccaaatccgttgtcgggcttgttattccgacgggctattcgtttaacctcgac
ggcacatccatctatttatcaatggcgactgtctttttggcacaggtgtttggagtagac
ctcagcatcggccagcaaattacgattatcctcgttctgatgctgacatcgaagggagcg
gcaggtgtgacgggaagcggatttatcgtccttgcctcaacgctgtcagcgctgcaggtc
attccgctggaggggcttgcactcctgctcggggtcgaccgtttcatgagtgaaggaaga
gccattgtgaacctgatcggaaacggaatcgccacgatcattgttgccaaaagcgaaaat
gaatttgatgaagcaaaaagcatagaggctgttgaaggcatgaaaaaaatgaaaacagca
gtctga

DBGET integrated database retrieval system