KEGG   Bacillus subtilis subsp. subtilis 168: BSU04480
Entry
BSU04480          CDS       T00010                                 

Symbol
ydbI
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: AI-2E_transport
Other DBs
NCBI-GeneID: 939948
NCBI-ProteinID: NP_388329
Pasteur: BG12076
BSORF: BG12076
UniProt: P96604 A0A6M3ZCW1
Position
501579..502631
AA seq 350 aa
MAALVKFFQHPGVRRFSIFVVLTGVLYLFKSMINLILLTFIFTFLMDRLELVVRQFVSQF
FRVSQRVVITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKHIAYHPDSIPFFDEITS
VFGDINISSYVKEGFNVVYTYLADISTFGLQVVMALILSMFFLFEKKRLSEFMAKFKTSK
LRVFYEEIAFFGSKFARTFGKVLEAQFIIALVNCILTFIALWIMHFPQLFGLSIMVFFLG
LIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIETYFLNPKLMSAKTELPIFF
TFTVLIFSEHFFGIWGLIIGIPIFVFLLDILDVTNKEDRSKGPRENSDKK
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggccgctttagttaaattttttcagcacccgggagtaaggcgtttctccatctttgtc
gtgttaactggtgtgttatatctatttaagagcatgatcaacttaatattgcttaccttc
attttcacatttctaatggatcgtttggagcttgtcgtgcggcagtttgtaagccagttc
ttccgcgtgagccagcgggttgtcattacgtttctttacatgttgctggctgtgctgctt
acagtcgggggctttgtgttttatccggtcgtcgcggcgcagatccagcagctggtaaag
cagattaaacatattgcgtatcatcctgacagcatccctttctttgatgagatcaccagt
gtcttcggagatattaacatcagttcatatgtcaaagagggcttcaatgtagtgtatacg
tatctggccgatatcagcacattcggcttgcaggtcgtgatggcgctcattcttagcatg
tttttcttatttgagaaaaaacggctttctgaattcatggcgaaatttaaaacgagcaaa
cttagggtcttttatgaggagattgcttttttcggaagcaaatttgcaagaacgttcggc
aaggtgctcgaggctcaatttatcattgcgctcgtcaactgtattctgacgtttatcgcg
ctttggattatgcattttccgcagctgtttgggctttcgattatggtgttcttccttgga
ttgatccctgtagcaggcgtcgtcatttccctgattccgctcagcattatcgcctacagc
actggcggtggaatgtatgtgctctacattgtccttgtcatattcgccattcatgcgatc
gaaacctatttcttaaatccgaagctgatgtcggcgaaaacagagctgccaatctttttc
accttcacagtactcattttctctgaacacttcttcggcatttggggtttaattatcggg
attccgatctttgtgtttctccttgatattctggatgtcaccaacaaggaagataggtct
aaaggaccccgagagaatagcgataaaaagtag

DBGET integrated database retrieval system