KEGG   Bacillus subtilis subsp. subtilis 168: BSU04490
Entry
BSU04490          CDS       T00010                                 

Symbol
ydbJ
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU04490 (ydbJ)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU04490 (ydbJ)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_15 AAA_23 DO-GTPase2 AAA_30 TsaE DUF5906 AAA_22 RsgA_GTPase AAA_29 AAA_14 AAA_16 AAA Thymidylate_kin MobB NTPase_1 MeaB ATPase_2 AAA_19 DUF4162 NACHT AAA_18 cobW ATPase NB-ARC SMC_N AAA_5 Rad17 RecA KAP_NTPase AAA_25
Other DBs
NCBI-GeneID: 938228
NCBI-ProteinID: NP_388330
Pasteur: BG12077
BSORF: BG12077
UniProt: P96605 A0A6M3Z870
Position
502908..503834
AA seq 308 aa
MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKTTLIRIIVGLLKQNSG
SVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFANMHKKIADERLDEVVER
VGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNGLDPAGMKDFRDHIKELA
EMEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLQGTDQTTEKAIIEVQPQEKALN
WLTGNQYQAESQDGTIVVEVAKENIPELNRSLVGQDLNVFSITPYTQSLEDEFIKATTAH
QEEGEELV
NT seq 927 nt   +upstreamnt  +downstreamnt
atggctgagccgattttacatattgaaggcctcgataaaaaaattgggtctaaacagatt
ttaaaacagatcagcatggacgtcatggagggtgaaatcatcggccttctcggtccgaat
ggttccggaaaaacaacactcatccgtatcatcgtcgggctgttgaaacaaaacagcgga
agcgtgacaatcagcggattccagcatgatacagagtttgaaaaagcgatggaagcggtt
ggagcgattgttgagaaccctgagttctatccgtacctgacaggctgggaaaacctcaag
cactttgcgaatatgcacaaaaaaatagcggatgaacggcttgatgaagtggtggaacgt
gtcgggctgacgtcagcgattcatgataaggtgaaaacctattcccttgggatgcgccag
cgtctgggaatcgcccaggcaattcttcaccggccgaagcttctcattctagatgaaccg
acaaacggcctcgatcctgcggggatgaaggattttcgggatcatattaaggaactcgca
gaaatggaaggaacagctgtcctgttcgccactcatttattgcgcgaggttgaagacttg
tgcgaccgtgtcatcatcattcaaaaaggtgagatcaaagcggaagtcagcttacaagga
accgatcaaaccacagaaaaagcgattatagaagtgcagccgcaagaaaaagcgctcaat
tggctgacaggcaatcaatatcaagctgagagccaagacgggacgattgtagttgaggtg
gcaaaagaaaacataccggagctgaaccgatcacttgtcggacaagatctgaatgtattt
tccattacgccttacacgcagtcactggaagacgaatttataaaagcgacaacagctcat
caagaggagggagaagagcttgtctaa

DBGET integrated database retrieval system