KEGG   Bacillus subtilis subsp. subtilis 168: BSU04500Help
Entry
BSU04500          CDS       T00010                                 

Gene name
ydbK
Definition
(RefSeq) hypothetical protein
  KO
K01992  ABC-2 type transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Module
bsu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU04500 (ydbK)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254]
    BSU04500 (ydbK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_4 ABC2_membrane_2
Motif
Other DBs
NCBI-GeneID: 939944
NCBI-ProteinID: NP_388331
Pasteur: BG12078
BSORF: BG12078
UniProt: P96606
Position
503854..504594
Genome map
AA seq 246 aa AA seqDB search
MKLFNRKVTLVSLILMAVFQFFMALIIKRIVISAGTDENFIGYLSYTPSLNILLQALTIV
IAATIVSMEFDKKTIKFLLIRPVKRQKVFWSKLITVVMVSFYLYLAYYILALLFGLLFFG
TSVTAESKTLLVNTLALIGSNWLEAVMMGLFGLLCSSLFRNSAVAVVVSFVVLYGASTLV
QLMKLFENKWGSFLLFANTDFTQYRSGETALFSGMTPLFSIGILIIHAIFFIVVGWWCFC
KRDVRV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttttaatcggaaggtcactttggtttctcttatcctgatggctgtctttcaa
ttcttcatggcattgatcattaaacggattgtcatcagtgccggaacagatgaaaacttc
atcggctatttatcgtatacaccgagcctgaacattttgctgcaggctttaacgatcgta
attgcagcaacaattgtttcgatggaatttgataaaaagacgatcaaatttttgctcatt
cgtccggttaaacgccaaaaggtcttttggtcaaaattaatcacagtcgtgatggtcagc
ttctatttgtatttggcatactacattctggcattattattcggtctcttgttttttggc
acatcggtgactgcggaatcaaagacattgctggtcaacaccttggcgctgatcgggtca
aactggcttgaagctgtaatgatgggattattcgggctgctttgttcttcgctgttccgc
aatagcgcggtagcagttgttgtttcttttgtcgttttatacggagcgagtacacttgtt
cagctcatgaagttgtttgaaaacaagtggggcagctttttgctttttgcgaacactgac
tttacgcaatacagaagcggagagacagcgttgttttcaggcatgacgccattgttttca
attggaattctcatcatacatgccatattcttcatcgttgttggctggtggtgcttctgt
aaacgggatgttcgggtctaa

DBGET integrated database retrieval system