KEGG   Bacillus subtilis subsp. subtilis 168: BSU04510
Entry
BSU04510          CDS       T00010                                 

Symbol
ydbL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938227
NCBI-ProteinID: NP_388332
Pasteur: BG12079
BSORF: BG12079
UniProt: P96607 A0A6M4JF59
Position
504689..505024
AA seq 111 aa
MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYMIYKMKTGIRYFIIYL
YASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQDRDANPV
NT seq 336 nt   +upstreamnt  +downstreamnt
ttgaggaactttattaccgctttaccgatcgtattgctgcttggattctcatttgtgtca
ttcatgtttcagtttgaacatcttgtttatttcaggctcgcgcttgggttgttttctctc
gtgggactgtacatgatatataaaatgaagacgggcatccgctattttatcatctatctg
tatgccagctggattgtgttggccgcagtgaccgcttttgaagagccgattttctcaagc
tttttctttggcggcctggtgatgacgatgggttacctgacatatatgctgatttatctc
ggcatgaaacaagaccgggatgcaaatcctgtgtaa

DBGET integrated database retrieval system