KEGG   Bacillus subtilis subsp. subtilis 168: BSU04520
Entry
BSU04520          CDS       T00010                                 

Symbol
ydbM
Name
(RefSeq) acyl-CoA dehydrogenase YdbM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Other DBs
NCBI-GeneID: 939949
NCBI-ProteinID: NP_388333
Pasteur: BG12080
BSORF: BG12080
UniProt: P96608 A0A6M4JFN7
Position
505152..506297
AA seq 381 aa
MSLFIQNDQQRQWMEKIGRIADEFQQTAAEDDEQGRFPAEKIQKLRDAGYTALTLPASHG
GGGISVYDMLLFQERLARGDAPTALSIGWHLSVIGELGEGNSWDEDVFAFVAKEVQNGAV
INRAATEAKTGSPTRGGRPGTHAVKKDGKWAVNGRKTFTTMSQALDYFLVTAWIEDKQTT
GVFLIHKDDPGLSIEETWDMMAMRATGSHDLVLNEVMLDENKLVELLQGPRGAKPNGWLL
HIPAIYLGVAQAARDYAVQFASEYSPNSLNGPIKNVPAVQQRTGEMELELLNARHFLFHI
AQLYDDPVRRPHLTSELGAAKHIVTNAALSVVDKAMRIVGAKSLERTNPLQRYYRDVRAG
LHNPPMDDAVIHKLAAEAFES
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtcattatttatacaaaacgatcaacagcggcaatggatggagaaaatcggacggatt
gcggatgaatttcagcaaacagctgctgaagatgacgaacagggacgttttcctgcagag
aaaatacaaaaactgcgtgatgctgggtatacagcattaacattgccggcatctcatggc
ggagggggcatttctgtttacgatatgctcttgtttcaagaacggcttgcacggggagat
gctccgacggctcttagcatcggctggcatttgagcgtgatcggggagcttggagaaggc
aacagctgggatgaagacgtatttgcatttgttgccaaggaagtccaaaacggagccgtc
attaacagggcggcgactgaagcgaaaaccggaagcccgacaagaggagggcgtcccggt
acacacgccgtcaaaaaggatggcaaatgggcagtgaacgggagaaaaacctttacgacg
atgtcacaagctctggattattttttagtaaccgcatggattgaggacaaacaaacaaca
ggcgtgtttctcattcataaagatgatcccggcttgtcgattgaagaaacgtgggatatg
atggcgatgcgggcgactgggagccatgaccttgtactgaacgaagtaatgcttgatgag
aataagctggtggaactgcttcaagggcctcgtggagctaagccgaatggctggctgctt
cacattcctgcgatttatcttggtgtggctcaagctgctcgtgactatgcagtgcaattt
gcatctgagtattctccaaacagcttgaatggaccgatcaagaatgtcccggccgtacag
caaagaacaggcgaaatggagcttgaactgctcaatgccagacactttcttttccatatc
gctcaattgtatgacgatccggtgcggcgtccacacttgaccagcgagctcggtgcggcg
aaacatatcgtcacaaacgctgcgctgtctgttgttgataaagcgatgagaattgtcggg
gccaaaagcctggaacgaaccaacccgcttcagcgctattaccgtgatgtgcgcgccggt
cttcacaacccgccgatggatgacgccgtgatacacaagctggcagctgaagcgtttgag
tcataa

DBGET integrated database retrieval system