KEGG   Bacillus subtilis subsp. subtilis 168: BSU04530
Entry
BSU04530          CDS       T00010                                 

Gene name
ydbN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Fur_reg_FbpB Ribosomal_S20p
Other DBs
NCBI-GeneID: 938190
NCBI-ProteinID: NP_388334
Pasteur: BG12081
BSORF: BG12081
UniProt: P96609 A0A6M4JFK7
Position
complement(506322..506501)
AA seq 59 aa
MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRIDRKHQKNLQEQNNT
NT seq 180 nt   +upstreamnt  +downstreamnt
gtgaatacaaacatgtcaggagggcgccggagcatgccgaagcgtaaagtgaaaacttac
caacagctgatccaggaaaacaaagaggcgattatgggcaatccaaagctgatgaacgtt
atttatgacaggatcgaccgcaagcatcaaaaaaatctgcaagagcaaaacaatacataa

DBGET integrated database retrieval system