KEGG   Bacillus subtilis subsp. subtilis 168: BSU04540
Entry
BSU04540          CDS       T00010                                 

Symbol
ydbO
Name
(RefSeq) transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Cation_efflux ZT_dimer LtrA
Other DBs
NCBI-GeneID: 938225
NCBI-ProteinID: NP_388335
Pasteur: BG12082
BSORF: BG12082
UniProt: P96610 A0A6M3Z7K8
Position
506866..507738
AA seq 290 aa
MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGLNNGTDIVASVAVLIG
LRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGKAIAGGTTETPNLIAAW
TALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSAGAFIGVFSSQLKLPWVD
PVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTVGRIENVHRLKDVKARYLG
STVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVHVHVEPDDIK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggagcggacagaaaatctgaaaaagggagaaaaaggggcgctcctcaatatttttgca
tatgtcatccttgctgttgtaaagctagttatcgggattctatatcattctgaagcgctg
agagcagacgggttaaataatggaacagatattgttgcgtcagtagcagtgctgatagga
ttgcggatttctcaaagaccggctgacagcgatcatccatacggccattatcgggctgaa
acaatttcgtctcttgttgcgtcttttattatgatggcagtcggcattgaagtgttaatc
ggcggaggaaaagcgattgcgggcggcacaacggaaacgccaaatcttatcgcggcatgg
acggcgttaggcagtgctgtgtttatgtatggcatctatttatataacaaaaggctggca
gcgtccattaaaagctctgccctgatggcagcggcaaaggacagcaggtcagacgctttt
gtaagtgccggcgcgtttatcggtgttttttcgtcccagctgaagctgccgtgggttgat
ccggtaacggcttttatcatcggcatcatcatttgcaaaactgcgtgggatatctttaaa
gacgcttcacattccttaacagacggcttccatttaaaagatcttgagccttacaaacag
accgtcggcaggatcgaaaatgtgcatcgcctaaaggatgtgaaagcgaggtatttaggc
agtacagttcatatcgagatggtgattacggttgatccgaagcttacagtagaagaaggc
catggagtggcggatgaagtagaagacaaaataaaacatgaacacgatgtcactcatgtt
catgttcatgtagagcctgacgacataaaataa

DBGET integrated database retrieval system