KEGG   Bacillus subtilis subsp. subtilis 168: BSU04560Help
Entry
BSU04560          CDS       T00010                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00473  D-Alanine metabolism
bsu00550  Peptidoglycan biosynthesis
bsu01100  Metabolic pathways
bsu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSU04560 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU04560 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BSU04560 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU04560 (ddl)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BSU04560 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Precursor biosynthesis
  Amino acid ligase
   BSU04560 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST GARS_A ATP-grasp_3 DUF4573
Motif
Other DBs
NCBI-GeneID: 938224
NCBI-ProteinID: NP_388337
Pasteur: BG11932
BSORF: BG11932
UniProt: P96612
Position
508248..509312
Genome map
AA seq 354 aa AA seqDB search
MYGGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEKGEWVRGARLTEPVSNVKMLQFE
QGGSAFSPAALNQEMFPQEASQQNEAIDVVFPLLHGPNGEDGTIQGMLELLNIPYVGNGV
LASSAGMDKVVMKHLFAQVGLAQAKYAAFLKKDWTRSPKESCEEVEQELGYPCFVKPANL
GSSVGISKCRNREELQKAFELAFQYDRKVVVEEGINGREIEIGVLGNDDPKCSVVGEIAP
KTDFYDYKAKYEDGDTDLMIPAIVTDEEYATISDMAIKAFKAIDGSGLVRADFFLTADGE
VLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVELAKERHAEKQLIKHTF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtacggaggaaagtcggcagaacataatgtttccctgcagacagctctggctgtaatc
aaagcgctaaatactgagaagtttgatatacatccgatttatataacagaaaaaggcgaa
tgggttagaggcgcccgtttaactgaacctgtttcaaacgtgaaaatgcttcaatttgag
caaggaggcagtgctttttctccagctgccctgaaccaggagatgtttccgcaggaagcg
tcacagcaaaatgaagccatcgacgtcgtattcccgctcctccacggaccgaacggagaa
gacggtacgatccagggaatgctcgagctgttgaacattccttatgtcggcaacggagtg
cttgcttcctcagctggcatggataaagttgtcatgaaacatttatttgcgcaggttggc
cttgctcaggctaaatacgcagctttccttaagaaagactggactcgttctccgaaagaa
agctgtgaggaggttgaacaggaattaggctacccttgcttcgtaaaaccggcgaacctc
ggctcaagtgtcggaatcagcaaatgccgaaaccgtgaagaactgcaaaaagcgtttgag
cttgctttccaatatgaccgcaaagtcgtcgttgaagaaggaattaacggccgcgagatc
gaaatcggcgttcttggaaatgatgatcctaaatgctctgttgtgggagaaatcgcaccg
aagacagatttctacgattacaaagcgaaatatgaggatggagatactgatctgatgatt
ccggcgattgtgactgatgaggaatacgcaacaatcagtgatatggcgatcaaagcgttt
aaagcgatcgacggttcaggactcgtcagagcggactttttcctgacagctgacggcgaa
gttctgatcaatgaagtcaacacaatgcctggctttacacctttcagcatgttcccgttg
ctctggaaagaagccggagtggaatatgctgacctgattgaacagcttgtggagcttgca
aaagaacgccacgctgaaaaacaattgattaagcatacattctaa

DBGET integrated database retrieval system