KEGG   Bacillus subtilis subsp. subtilis 168: BSU04600
Entry
BSU04600          CDS       T00010                                 

Symbol
ydbT
Name
(RefSeq) hypothetical protein
  KO
K08981  putative membrane protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BSU04600 (ydbT)
SSDB
Motif
Pfam: bPH_2 bPH_4 DUF334 Spec3
Other DBs
NCBI-GeneID: 938221
NCBI-ProteinID: NP_388341
Pasteur: BG12087
BSORF: BG12087
UniProt: P96616 A0A6M4JF67
Position
513283..514764
AA seq 493 aa
MMSEPKRLHPVAVILNLCHTIIQTIKNIILPFFFVYIVNSNHTVRFYGAIALGVLFIWLV
AASIIKWRRFTYRIEDDEFRIEEGLFVTKKRYISIDRIQTMNTSAGLVQQIFKLVKLQIE
TAGGGKEAEAVLSAISVEEAERIKEAVFKKKAQRRENELDEERLEAEEELDPSVEVQEHY
RMNAKELLMAASTSGGIGVIISAVFALISQLDEVLPMDWLFDKFSFLQHASIGIYAVLIF
IGLFIAWIFSIAGMMFRYANFQIIKKEQELVISRGIIEKHQVTIPLRKIQAIKIKENIIR
QLFGFVTVSIVSAGGGDREKEEGALTILFPMIHKKKLPHMLRTFTPEYTLEENCRRLPRR
ALKRYLFRSVIFSLFLIIPLCIFFQPWGYLSVILLPIELLFGYLAYKEAAWTINGDRLQL
TSRFIGRTTAIVLKKRMQVCKFSQSYFQKKGRLYTISTSVKSSSHMEELTVRDVGEEDAA
FILKWYSYEKADG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgatgtctgaaccgaaacgcctgcacccggtggcagtcattttgaatttatgccatacc
attattcaaacgataaaaaatatcattctgccattcttttttgtgtatattgtcaattca
aaccatactgtccgtttttacggagccattgcgctcggtgtgctgttcatctggcttgta
gcggcaagcattatcaaatggagaaggtttacctatcgaattgaagatgatgaatttaga
attgaagaaggcttatttgttacgaaaaaacgatacatatcgattgatcggattcaaaca
atgaatacgagcgcgggccttgtccagcaaatctttaagcttgtgaagctgcaaattgaa
acagcaggcggaggcaaggaggcagaagccgttctttctgctatttctgttgaagaagcg
gaacgcatcaaagaagctgtctttaagaaaaaagcgcaaagacgagaaaatgaacttgat
gaagaacggcttgaagctgaagaggagttggatccgtccgttgaggtgcaagagcactat
cgcatgaacgcgaaagaattgctcatggccgcttctacctccggcggaatcggagtcatt
atctccgctgtatttgcacttatttcccagcttgatgaagtgctgccgatggattggtta
ttcgataaattttccttccttcagcacgccagcatcggtatttatgcggtactcattttt
atcggtttatttatcgcctggattttcagcatcgcgggcatgatgtttagatacgcgaac
tttcaaatcataaaaaaagagcaggaactggtgatttcaaggggaattattgaaaaacat
caagtcacgattccgctgcgaaaaatacaagccattaaaatcaaagaaaatatcattcgc
cagcttttcggctttgtaacggtgtccatcgtcagcgcaggaggcggcgaccgggaaaaa
gaagaaggcgctttgaccattctctttccaatgattcataaaaaaaagcttccgcacatg
ctccgaacatttacgccggaatacacgctggaagaaaactgccgccgcctgccgcggcgc
gcgttgaaacgctatttgttccgttctgtcattttttcactctttttgatcatcccgtta
tgtatcttctttcagccatggggctatctgtcagtgatcctgctgccgatagaattgctc
ttcggctatctcgcgtataaagaggctgcatggacgatcaacggggaccgtcttcagctg
acgtctagatttataggcagaacaaccgccattgtactgaaaaaacgaatgcaggtctgc
aagttcagccaatcctatttccaaaagaaaggccgcttgtataccatttctacttcggtg
aaatcatcgagccatatggaagagttaacggtgagggacgtaggtgaagaggatgcagcc
ttcattttaaagtggtactcatatgaaaaagcggacggttaa

DBGET integrated database retrieval system