KEGG   Bacillus subtilis subsp. subtilis 168: BSU04610
Entry
BSU04610          CDS       T00010                                 

Symbol
ydcA
Name
(RefSeq) rhomboid protease YdcA
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Rhomboid DUF4605
Other DBs
NCBI-GeneID: 939936
NCBI-ProteinID: NP_388342
Pasteur: BG12088
BSORF: BG12088
UniProt: P96617 A0A6M4JFP5
Position
complement(515016..515615)
AA seq 199 aa
MFIRTENFQTFIRLYPVVTFILALQAVLWLFFSLPAHSVVLWRDTVTGYNLGVANGEWWR
LITPILLHAGFTHLLFNSMSIFLFAPALERMLGKARFLLVYAGSGIIGNIGTYVTEPLDY
VHVGASGAIFGLFGVYLFMVLFRNELIGQEHSKMIITLLAFAVLMSFINSNINMMAHLFG
LCGGFLLSFLCVQKKERRY
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtttatacggactgaaaattttcaaacatttatcaggctttaccccgttgtcaccttt
atattggctttgcaagctgttctctggctgtttttttcacttcctgcccattcagtcgtg
ttatggagggataccgtcacaggctataatctaggtgtcgcaaacggtgaatggtggcgg
cttatcacaccgattttgctgcacgccggtttcacacatctgctgtttaattccatgtcc
atctttttatttgccccggctttggaacgcatgctgggaaaagcgcgtttccttcttgta
tacgccggctccggcatcatcggcaatatcggcacttatgttacagagccgcttgattac
gtgcatgtcggggcttcaggcgccattttcgggctatttggcgtatacctgtttatggtt
ctttttcgcaatgagttaattgggcaggagcattccaaaatgatcatcacactgctcgca
tttgccgttctcatgtcgtttatcaactccaatattaacatgatggcccatttgtttgga
ctatgcggcgggtttcttctttcgtttttatgcgtgcaaaaaaaagagcggcggtattaa

DBGET integrated database retrieval system