KEGG   Bacillus subtilis subsp. subtilis 168: BSU04630
Entry
BSU04630          CDS       T00010                                 

Symbol
ydcC
Name
(RefSeq) sporulation protein YdcC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF4367 LPAM_2
Other DBs
NCBI-GeneID: 938166
NCBI-ProteinID: NP_388344
Pasteur: BG12090
BSORF: BG12090
UniProt: P96619 A0A6M3ZIE9
Position
516241..517257
AA seq 338 aa
MKKVRKSFVLLLTGLLAVLILSACGQKTQQDIVAGLDEKAKEYTSYKAKAKMTIETGSEP
QVYNVEIWHKKPSLYRVYLENPKKDQNQVILRNENGVFVLTPSLNKSFRFQSDWPNNSSQ
VYLFESLVKDVQNDSDAVFTAKEKKYVFETKTNYQHNKMLPTQEITFNKKDMSPSSVKVM
DTDRKVMVKVEFSSFEFNKQFDKESFDEKKNMTLSQMDVATSAKPSDTFAVKTPLELPLG
VKLLEEKDISTEDGKRIIMTYGGEKSFTLIQEKAQIAKASSSVTLNGEPVNLGYTIGALS
DASLSWTYDGVDYLLSSKDLSKEEMVTVAKSMQGQSSK
NT seq 1017 nt   +upstreamnt  +downstreamnt
ttgaaaaaggtgagaaaaagctttgttttgcttttaacgggactgcttgctgttcttatt
ctttctgcctgcgggcaaaaaacacagcaagatattgtggccgggttagatgaaaaggcg
aaagaatacacctcgtacaaagcaaaagcgaaaatgaccatcgagacagggagtgagcct
caagtatacaatgtggaaatctggcacaaaaagccgtctctgtacagggtttatttagaa
aatccgaaaaaggaccaaaaccaagtcattttacgaaatgaaaacggagtattcgttctc
acgccgtctttaaataagagcttcagatttcaaagcgattggccgaacaacagcagccag
gtttatctgtttgaatcgctcgtaaaggatgttcaaaacgattcggatgcagttttcaca
gcgaaagaaaagaaatacgtatttgaaacaaaaacaaactatcagcataacaaaatgctg
cccacgcaagaaatcacatttaacaaaaaagatatgagcccgtcatctgtcaaagtgatg
gatactgaccggaaagtgatggtcaaagtagaattcagcagctttgaatttaataaacaa
tttgataaagaatcatttgatgaaaagaaaaatatgaccctttctcaaatggatgtcgcc
acaagcgcaaagccttccgatacatttgcggtcaaaacgccgctggaactgccgcttggc
gtcaagctgcttgaagaaaaagatatatctactgaagacgggaagcgcatcatcatgacg
tacggaggagaaaaatcatttacgttaattcaggaaaaagcccagattgccaaggcttcc
tcctccgttacgctgaacggcgaaccggtaaatctcggctacaccatcggcgccctgtcg
gatgcatcattatcatggacatatgacggcgtagattaccttctctcttctaaagatctt
tctaaagaggaaatggtgacagtagcgaaaagcatgcagggacaatcatcgaaataa

DBGET integrated database retrieval system