KEGG   Bacillus subtilis subsp. subtilis 168: BSU04650
Entry
BSU04650          CDS       T00010                                 

Symbol
endB
Name
(RefSeq) antitoxin EndoAI
  KO
K07723  CopG family transcriptional regulator / antitoxin EndoAI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU04650 (endB)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU04650 (endB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Ribbon-helix-helix
   CopG family
    BSU04650 (endB)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    BSU04650 (endB)
SSDB
Motif
Pfam: RHH_1 RHH_5 HicB_lk_antitox
Other DBs
NCBI-GeneID: 938177
NCBI-ProteinID: NP_388346
Pasteur: BG12091
BSORF: BG12091
UniProt: P96621 A0A6M3Z7M2
Structure
Position
518657..518938
AA seq 93 aa
MSESSARTEMKISLPENLVAELDGVAMREKRSRNELISQAVRAYVSERTTRHNRDLMRRG
YMEMAKINLNISSEAHFAECEAETTVERLVSGG
NT seq 282 nt   +upstreamnt  +downstreamnt
ttgtctgaatccagcgcaagaaccgaaatgaaaatcagcttgcccgaaaacctagtagct
gaattggatggtgtagcgatgcgggagaaacgaagcagaaacgaactgatatcacaagca
gtgagagcgtatgtcagcgaacgaacaactcgtcacaaccgtgatttgatgagacgcggc
tatatggaaatggcgaaaatcaacctgaatatttcttctgaggctcactttgcggagtgc
gaggctgaaacgacagttgagcgcttagtcagcggaggataa

DBGET integrated database retrieval system