KEGG   Bacillus subtilis subsp. subtilis 168: BSU04660
Entry
BSU04660          CDS       T00010                                 

Symbol
ndoA
Name
(RefSeq) mRNA interferase EndoA
  KO
K07171  mRNA interferase MazF [EC:3.1.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bsu02048]
    BSU04660 (ndoA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     BSU04660 (ndoA)
Prokaryotic defense system [BR:bsu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    BSU04660 (ndoA)
SSDB
Motif
Pfam: PemK_toxin
Other DBs
NCBI-GeneID: 939935
NCBI-ProteinID: NP_388347
Pasteur: BG12092
BSORF: BG12092
UniProt: P96622 A0A6M3ZAW3
Structure
Position
518943..519293
AA seq 116 aa
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHV
EIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
NT seq 351 nt   +upstreamnt  +downstreamnt
ttgattgtgaaacgcggcgatgtttattttgctgatttatctcctgttgttggctcagag
caaggcggggtgcgcccggttttagtgatccaaaatgacatcggaaatcgcttcagccca
actgctattgttgcagccataacagcacaaatacagaaagcgaaattaccaacccacgtc
gaaatcgatgcaaaacgctacggttttgaaagagattccgttattttgctggagcaaatt
cggacgattgacaagcaaaggttaacggataagattactcatctggatgatgaaatgatg
gataaggttgatgaagccttacaaatcagtttggcactcattgatttttag

DBGET integrated database retrieval system